KEGG   Astyanax mexicanus (Mexican tetra): 103041820
Entry
103041820         CDS       T05042                                 

Gene name
ankrd53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53 isoform X1
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
KEGG Orthology (KO) [BR:amex00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:amex03036]
    103041820 (ankrd53)
Chromosome and associated proteins [BR:amex03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    103041820 (ankrd53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank_3 Ank
Other DBs
NCBI-GeneID: 103041820
NCBI-ProteinID: XP_022534279
Position
16
AA seq 402 aa
MAEAGSGTRRKVRWLQRAPPAGDLFQAAVSGDQEWLSFSLRRTLSPSQPNKQGLTVLHVA
AQHGRLDCVKLLVEAYCVDVNASCPCGRRPLHMVLSPQSKPHSHTCIIYLLQHGAQHNVS
TDEGLTPLHMAAAEGLKNCVETLVEVGADTHAIDKHGHTPLDLARLWGHRVIARFLKNAM
WQRDKKKEMEERKALQNLRHNLMWLYRTAESKEKVTREAVNVQKVTEWAEKKGLPLLWPP
LRSSGALNHSCFPSTEPPITKSKKKFKESSPTPMWDISPNPCRPPPASVSRPQEVRMGVH
PEKAPLEPDLRNRVTLSCFEDGRIHYTASWENIPQSVPALPMDVIQRGLFPSAFPSRITS
PLPFQTSSMLDLPHRGCTAKPGDSPWTEVAMHLAEELELGHY
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggcagaggctggcagtgggactcgtcgtaaggtgcgctggctgcagagagcgccgccc
gcaggtgatttattccaggccgcggtgtccggagatcaggaatggctgagcttcagtctg
aggagaacactctcaccctcacagcccaacaaacagggtctcacagtgctccatgtggct
gctcagcatggccggctcgactgcgtaaagctgcttgtggaggcttactgtgttgatgtg
aacgctagctgtccgtgtgggcggagacccctgcacatggtgctcagtccacagagcaaa
ccccactcacacacctgcattatatacctgctgcagcacggagcccagcacaacgtatcc
acagatgaaggactgacccctctgcatatggctgcagctgaaggcctgaaaaactgtgtt
gaaacgctggttgaggttggagcagacacacatgccattgacaaacacggacacacacca
ctcgacctcgctcgcttatggggtcacagggtcattgccaggtttctaaagaatgccatg
tggcagagagataagaagaaagaaatggaggaacgtaaagctctgcagaatctccggcac
aatctgatgtggctgtacaggactgcagagagcaaggaaaaggtgaccagagaggcggtt
aatgtgcagaaggtcactgagtgggctgagaagaaagggcttcctttgctctggcctcct
ctcaggagctcaggagctttaaaccatagctgcttcccatccactgagcctccgattaca
aagagcaaaaagaaattcaaggaaagttcacccacaccaatgtgggacatctctccaaac
ccctgtagacctcctccagccagtgtcagcagaccacaggaggtacgaatgggagtccat
ccagagaaagctccactagagccagatctacgtaatagagtgactttgagttgttttgag
gatggccgcatccactacactgcatcatgggagaacattccacagtcagttcctgccctg
cccatggatgtcatccaaagaggcctgtttccatctgcttttccctcccgtatcacttct
ccactgcccttccagaccagcagcatgctggacctgcctcatcgaggttgtactgccaaa
ccaggagactcaccttggactgaggtggcgatgcacctcgcagaagagctggaactgggc
cattactaa

DBGET integrated database retrieval system