KEGG   Astyanax mexicanus (Mexican tetra): 103042447
Entry
103042447         CDS       T05042                                 

Gene name
mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103042447 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:amex03000]
    103042447 (mecom)
Transcription factors [BR:amex03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    103042447 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-H2C2_5 zf-C2H2_jaz zf-C2H2_8 zf-BED PyrI_C
Other DBs
NCBI-GeneID: 103042447
NCBI-ProteinID: XP_022541646
Position
Unknown
AA seq 1159 aa
MGVWSRRRLEVGEKFGPYEGTPNHGGPHHAYGCEKTGFDGCVCDSRNWLRHVQISPSSHQ
YNLTAYPIHEQIFYSVVREVHPGEELTLFMKAEEFSCDTMPPDIHEEREFRCEDCEQHFS
SGPELIEHQKESCSSRLHSHFILPEQDVPLSDGENTELHPLLLHPPDSPQECKECEQVFP
DTQSLEAHSLSHSEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCSKQVFTDPS
NLQRHIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSSVKPFICKSLTSFICEVCHKS
YTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAAGGLFGPAI
TLPGGPGLDKSALAGIGPGSAGLADYFGGNRHHNGLTFPAAPPAFPFGFPGLFPSGLYHR
PAIMPASSPVKSLPGADLQKSPLSLPGMQESHEFLKSFHKHSLNGEAEEEVERQGEGHAH
KPKISDQSESSDLDDVSTPSGSELESTSGSELDSDAESDRERDRDRVKENMKGPKRKPGS
SNIDQRPSLISSSSSSNATNGSGASMPPQGLFSPPLDENTAVSGAVNDSIKAIASIAEKY
FGSTGLANLHDKKGGALPYPSMFPLSFFPAFSPPVYAFHEGEPLRPPAHKEEPGSSPVET
KRPQGRTTESPFDLTTKRKEERLAPTCVSSKPEASLVRSANQDQPLDLSLGGRSRGTCIR
GKESRKNHVFGEEGFEAELPKGDPSLQHARPTPFFMDPIYRVEKRKASDPFEMLKEKYMR
PAPGFLFHPQFRMPDQRTWMSAIENMAEKLESFGSLKSDAGDIMRSVPSMFDFRAPPTTL
PETLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHIR
NIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGTAMSSPQSELDSSSAILDDKEDSYFN
EIRNFITNSSQTATSPPHSDEGLNDSHFEADKAAVIQKSHQDEEEGEERGTEEEEVEHSD
AAGKPTKKATSSNIEDDVSGDLDFDGPTDLDLNCKSSPQRFDDEEEDEEHSGFSTLDHIR
RFSMDEAELSDVDVGGFDSTHLQETIKQPLYRKSKSQAYAMMLSLADKDPLPPSPHAGSV
WHTLGRAAESNAIQSLSHV
NT seq 3480 nt   +upstreamnt  +downstreamnt
atgggcgtctggagcagaaggaggctggaggtcggtgagaagtttggaccctatgagggg
acgccaaatcatggtgggccacatcatgcctatggctgtgagaagactggttttgatggg
tgtgtgtgtgatagcaggaactggctaagacacgtccagatatcgccatcctcgcaccag
tacaacctcacagcctatccgatacatgagcagatattttatagtgtggttcgcgaggtt
catcctggtgaagaactcacactcttcatgaaggctgaggagttttcctgtgacacgatg
cctccagatatccatgaggagcgtgagtttcgctgtgaggactgtgagcagcacttctcc
tcggggccagagctgatagagcatcagaaggagtcctgttcctcccggctccactcacac
ttcatcctgcccgaacaggacgtcccgctcagtgacggagaaaacacagagcttcaccca
ctcctgctgcacccgccagactccccacaggagtgcaaagagtgtgagcaagtatttcct
gacactcagagtctggaggctcactctctctctcactccgaggagcgggagtataagtgt
gaccagtgccccaaggccttcaactggaagtccaacttgattcgtcatcagatgtcacat
gacagcgggaagcattatgaatgtgaaaactgctcaaagcaggtgtttacagaccccagt
aacttgcagaggcacatccgttcccagcacgttggcgcccgggcacacgcctgccccgac
tgcggcaaaacgttcgccacctcgtccggcctcaaacagcacaaacacatccactcctct
gtcaagcccttcatatgtaagtctctcacctccttcatatgtgaggtttgccacaagtcc
tacacccagttctcaaacctgtgcaggcacaaacgcatgcatgcagactgccggacgcag
atcaagtgtaaggactgtggccagatgtttagcaccacctcttcactcaacaagcaccgg
cgtttctgcgaggggaaaaatcattttgctgccgctgggggactttttgggccagccatt
actctgcctggtggccccgggctggacaagtctgctttggccgggattggacccggatca
gctggtctggcggactattttggaggcaaccggcatcacaatggactgacgtttccggct
gccccaccagcgttcccattcggttttccaggactctttccatctggactgtaccatcgg
cccgcaatcatgccagcctcttcaccggtaaagagtctgccaggagcagaccttcagaag
agtcccttatccttacctggaatgcaagagtcccatgagtttctgaaaagcttccacaag
cactccttaaatggtgaagcagaagaagaggtggagcgtcagggagaaggtcatgcccac
aagcccaagataagtgaccagtctgagagcagcgacctggatgatgtcagtacccccagt
ggaagtgagctggagagtacctctgggtcagaactggacagcgatgcagagagtgaccgg
gaacgtgatcgagacagggtgaaggaaaacatgaaagggcccaagaggaagcctggcagt
tctaacattgaccaaaggcccagcctcatcagcagttcaagcagcagcaatgccactaac
ggtagtggggccagcatgcctccacaggggcttttctctccacctctagatgaaaacact
gcagtgtccggagccgtcaacgactctatcaaagccatcgcctctattgcagagaaatac
tttggatctacgggcttggctaacctacatgataaaaaagggggtgctctgccataccct
tccatgtttccactgtctttctttcctgctttctcaccaccagtctacgcattccatgag
ggagagccactgagacctccagcccacaaggaggagccaggtagctcaccagtagagacc
aagagaccacagggcaggaccaccgagtcaccctttgacctcaccaccaagcgcaaagag
gaacgcctggctccaacatgtgtttcctcaaagcctgaggcgtcacttgtacgctcagcc
aatcaggaccagccactggacctgagtctgggtgggcggagccgaggaacatgcatcaga
ggcaaggagtcacggaagaaccatgtatttggagaggaagggtttgaggcagagcttcct
aaaggagacccctccctccagcatgcaagacccacccccttcttcatggaccccatctac
agggttgaaaagaggaaagccagtgatccgtttgagatgctgaaggaaaaatatatgcgt
cctgcgccaggcttcctcttccacccacagttccgcatgcctgatcaaagaacttggatg
tcagctatagagaacatggcggagaagttggaatcgtttgggtcgttaaagtctgatgct
ggtgacattatgcgatctgttccctccatgtttgacttccgagctccaccaaccacactg
cctgaaacactgctgcgcaagggtaaagagcgctacacctgcagatactgtggaaaaata
ttcccacgctcagccaacctcacacgccatctcagaacacacacaggagaacagccgtac
aggtgtaaatattgtgatcgctcgtttagcatttcctccaacctgcagcgccacatccgt
aacattcacaacaaagaaaaacccttcaaatgccacctgtgtgaccgctgctttggccaa
cagaccaacctggaccgacaccttaagaaacacgagaatggcacagcgatgtcatcacca
cagtcggagctggacagcagcagtgccatcctggacgataaggaggactcctactttaac
gaaatccgcaactttatcaccaacagcagccagactgccacctcacctccgcactctgat
gaagggttaaacgacagtcactttgaggccgataaagctgcagtcatccagaagtcacac
caggatgaggaggaaggggaggagcgtgggacagaggaagaggaggtggaacatagtgat
gctgccgggaaacccactaagaaggctacatccagtaacattgaggacgatgtcagcggt
gacctggactttgacggaccaaccgatttggacctgaactgcaaatcctcaccacagagg
tttgatgatgaagaggaggatgaagaacacagtggtttctccacgctggatcacatccgg
cgctttagcatggatgaagcagagctcagtgacgtcgatgttggaggctttgactccacc
cacctgcaggagaccattaagcagccactgtacaggaagtctaaatcacaggcatatgca
atgatgctctctctggctgataaagatcctctgcctccgtctcctcatgctggctctgtg
tggcacacactcggtcgtgcagctgaatctaatgccatccagtctctcagtcatgtatga

DBGET integrated database retrieval system