KEGG   Astyanax mexicanus (Mexican tetra): 103042897
Entry
103042897         CDS       T05042                                 

Gene name
rdh5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    103042897 (rdh5)
Enzymes [BR:amex01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     103042897 (rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 HMG_box
Other DBs
NCBI-GeneID: 103042897
NCBI-ProteinID: XP_007229641
Ensembl: ENSAMXG00000004866
UniProt: A0A3B1J6Y3
Position
Unknown
AA seq 333 aa
MDMEQIYEYIGKENVTTYAIGAFVLLWALIWLIRDSQEIDKISEKYVFVTGCDSGFGNLL
CRRLDKRGFNVLAGCLTEKGADDLKRVTSPKLKTCLLDVTNTASIQKAYEWTQKEVGDKG
LWGIVNNAGRALPMGPSEWMRNEDYICTLRVNMNGVIEMTTQFLPLIKKARGRIVNVASV
LGRVAANGGGYCISKFAVESFSDCLRRDIHYFGINVCIIEPGFFKTQVTSLEPIEKELHR
LWNQLTPEVKASYGEKYLDNYIKIQRLIMNAICDPDISKVTNCMEHALTSAHPRTRYSAG
WDAKLLWIPISYMPACVVDLALKLVLPRPAQSV
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggacatggaacaaatctacgagtatataggaaaggaaaacgtgaccacgtatgccatt
ggagcgttcgtgttgctgtgggcactgatatggctgatccgagacagtcaggaaatcgac
aaaatcagtgagaagtacgtatttgttactggctgcgactccggcttcgggaacctactg
tgcagacggctggataagcgaggtttcaacgtgctggccggctgtctaacagaaaagggt
gcagacgacctgaaaagagtgacgagccccaaactgaagacatgtttattggatgtgacg
aacactgccagtattcagaaagcatatgaatggacacagaaagaagttggagataaaggt
ctgtggggaatagtaaacaacgctggccgggccttacccatgggtccctctgagtggatg
cggaatgaggattacatctgcaccctgagggtgaacatgaatggtgtgattgagatgacc
acacaattccttccactaatcaaaaaagcccgtggccggatcgtcaatgtggcttcagtg
ctgggcagagtggcagctaatggaggcggctactgcatctccaagttcgcagtggaatct
ttctctgattgcctcaggagggatattcactatttcgggatcaacgtctgtataattgaa
cctggattcttcaagactcaggtgaccagcctggagccaatagaaaaggaacttcatcgg
ctgtggaaccaactgacacctgaagtaaaagcgagttatggagaaaaataccttgataat
tacatcaagatccagaggctgatcatgaatgctatttgtgacccagatataagcaaagtg
accaactgcatggagcatgcgctgacatccgctcacccacggacccgctacagtgccggc
tgggacgccaagctgctctggatccccatctcctacatgcctgcctgtgtggttgacctg
gctttaaaactggtgctgccccggccagctcagagcgtttag

DBGET integrated database retrieval system