KEGG   Astyanax mexicanus (Mexican tetra): 103043253
Entry
103043253         CDS       T05042                                 

Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00230  Purine metabolism
amex00240  Pyrimidine metabolism
amex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103043253
   00240 Pyrimidine metabolism
    103043253
Enzymes [BR:amex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     103043253
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_28 Thymidylate_kin
Other DBs
NCBI-GeneID: 103043253
NCBI-ProteinID: XP_007234039
Ensembl: ENSAMXG00000013318
Position
14
AA seq 322 aa
MDSLRLTVPLVHWLSWFMAPPCSAFRQKLNRALYSVYSSYPVISRSSERHLYRASPGLNM
VPTPKRACPSPLNDSMEKRIKRISIEGNIAAGKSTFVRALEEHDKAWEVVPEPIARWCNV
QTQHSDFEELTTSQKSGGNVLQMMYEKPERWAYTFQSYACMSRVRAQINSANGKLREAEN
PVQFFERSVYSDRYIFAANLYESECVNETEWAVYQDWHSWLHKQFGKHIELDGIIYLRAA
PERCMERLRVRGREEEQGIPLEYLEKLHYKHECWLQHRNMSMEFDYLNEVPILTLDVNDD
FRGDSIKCANMIEKVKEFLSTL
NT seq 969 nt   +upstreamnt  +downstreamnt
atggacagcctccgcctgaccgtccccctcgttcattggctgagttggtttatggctccg
ccctgcagcgctttccgccaaaaactgaaccgcgctttgtacagtgtgtacagtagctat
ccggttatcagtcggagctcagagcggcacctttaccgagcttctccgggtttaaacatg
gttccgacccccaaacgagcctgtcccagccctctgaacgacagcatggagaagaggatt
aaacgcatctctatcgagggtaatatcgctgcgggtaaatccacttttgtccgggctctg
gaggaacatgataaagcgtgggaggtagtaccggaacccatcgccaggtggtgcaatgta
caaactcagcacagcgactttgaggagctgaccacctctcagaagagcgggggtaacgtg
ctgcagatgatgtatgagaagccggagcgatgggcctacacgtttcagagctacgcctgt
atgagccgtgtgcgtgctcagatcaactccgccaatggcaaactgagggaagctgaaaat
cctgtgcagttcttcgagcgatcggtctacagcgacaggtatattttcgctgcaaatctg
tatgagagcgaatgtgtgaatgagactgagtgggctgtttaccaggactggcacagttgg
ctgcataaacagtttggcaaacacattgaactggatggcatcatctacctacgggcagcc
ccagagagatgtatggagcggctgcgtgtgaggggcagagaggaggagcaggggattcct
ctggagtatctggagaaactccactacaaacatgagtgctggctgcagcacagaaacatg
agcatggagtttgattacctgaatgaagtccccatcctcactctggacgttaacgatgac
ttcagaggagatagtatcaaatgtgccaacatgatcgaaaaggtgaaagagtttctgagc
actttatga

DBGET integrated database retrieval system