KEGG   Astyanax mexicanus (Mexican tetra): 103044488Help
Entry
103044488         CDS       T05042                                 

Gene name
cacng3
Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04010  MAPK signaling pathway
amex04260  Cardiac muscle contraction
amex04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103044488 (cacng3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103044488 (cacng3)
   04261 Adrenergic signaling in cardiomyocytes
    103044488 (cacng3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:amex04040]
    103044488 (cacng3)
Ion channels [BR:amex04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103044488 (cacng3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 Bax1-I
Motif
Other DBs
NCBI-GeneID: 103044488
NCBI-ProteinID: XP_007260344
Position
12
AA seq 367 aa AA seqDB search
MRVCNRGVQMLVTTAGAFAAFSLMTIAVGTDYWLYSPGVCRTKGSSDNDTTRKNEEVLTH
SGLWRQCCMEGMFTGVCKNIDHFPEDADYEQDAAEYLLRAVRASSLFPIMSVGLLFIGGV
CVAASEFYKSRHNVILSAGIFFVSAGLSNIIGIIVYISSNAGDPNQSESKRSHWYGWSFY
CGALSFIIAETVGVLTVHLFIDTHRALRASSRRSLRPRSRQSSLQRRLSSGSFRSRSRDL
ALYPLAATPPVLTRNSLVYGRGSFARFHHAAIADEGLALVGAGVGMGARALLPQSAVAPL
DNGLPPALLMAAHVRSPVEMAGVPSLERCKQNSSHPVGQNPQHASDPPKEGTLSPPSGTA
TRRTTPV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagggtgtgcaatcgtggagtgcaaatgctcgtcaccacggcaggggcttttgcagcc
ttcagcctgatgaccatcgctgtgggaacggactactggctctactcgcctggggtctgc
cggaccaagggttccagtgacaacgacacgactcgcaagaacgaggaggtgctcacacac
tccgggctttggcgccagtgttgtatggaaggcatgttcacaggtgtgtgtaaaaacatt
gatcacttcccggaagacgcagactacgaacaggatgcagcggaatatctgctccgggca
gtccgtgcctccagtcttttccccatcatgagtgtggggctgctgtttatcggcggtgtg
tgtgtggctgccagtgaattctacaagagtcgccacaacgtcatcctgagcgctgggatt
tttttcgtctcagctggcctcagcaacattatcggcatcattgtgtacatctcgtccaac
gcgggcgaccccaaccagagcgagtccaagcggagccactggtacggctggagcttctac
tgtggtgcgctgtccttcatcatcgccgagacggtgggcgtgctcaccgtgcacctcttc
atagacacgcaccgtgcactgcgtgcaagctcccgccgctcgctccgcccccgctcccgc
cagtcctcgctgcagcgccgcctctcctcgggctcctttcgctcacgttctcgagacctc
gccctctatccacttgcagccacgccccccgtgctgacacgcaactctctcgtctatggc
cgtgggagctttgcacggtttcaccacgcagccatcgccgacgagggcttggccttggtt
ggtgcgggcgtgggcatgggggcacgagcgctcctgccccaaagtgctgttgcaccactg
gataacgggctgcctccagcgttgctcatggctgctcatgtgcggagcccagtggagatg
gccggagtgcccagtctggagcgctgcaagcagaactcaagccacccggttggtcaaaat
ccacagcatgcatcagatccaccaaaggagggtacactctcgcctccaagtggcacagcc
acgaggagaaccacaccagtgtga

DBGET integrated database retrieval system