KEGG   Astyanax mexicanus (Mexican tetra): 103045949Help
Entry
103045949         CDS       T05042                                 

Gene name
wnk4
Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase WNK4
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
KEGG Orthology (KO) [BR:amex00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amex01001]
    103045949 (wnk4)
   01009 Protein phosphatases and associated proteins [BR:amex01009]
    103045949 (wnk4)
Enzymes [BR:amex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103045949 (wnk4)
Protein kinases [BR:amex01001]
 Serine/threonine kinases: Other
  Wnk family
   103045949 (wnk4)
Protein phosphatases and associated proteins [BR:amex01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103045949 (wnk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 103045949
NCBI-ProteinID: XP_022525162
Position
4
AA seq 1615 aa AA seqDB search
MSHAQVELPGLGFPSLPVDLDPECAERRSIRRNSYVIHKLNVDIESQFFNGALSWPSENV
LCENRTEEGKVDTCPPSPSPVSSPKTPTPQSCCSPSETPGPWRVSGQDPSSDSDPEAAKP
GKVKPRMESRWELEEKEDMETKAVATSPDGRYLKFNVEIGRGSFKTVYKGLDTETTVEVA
WCELQTRKLTKAERQRFSEEVEMLKNLQHPNIVRFYDSWKSTLKGHKCILLVTELMTSGT
LKTYLKRFKEMKLKLLQRWSRQILKGLHFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGD
LGLATLKRASFAKSVIGTPEFMAPEMYEEKYDEAVDVYAFGMCILEMATSEYPYSECQNA
AQIYRKVTSGMKPDSFYKVKVPELKEIIEGCIRMNKDERYTIQDLLEHTFFQEHNGVHVE
LAEEDDMEKSSLKLWLRMDDTKKLHGKYKDNNAIEFLFELYKDVPEEVAQEMVVLGFVCE
ADYKLVAKAMRDRVTAIKRQRERQRRLAEEQKKRKQEVAIEEELEPPSPKPVSRAPDSLA
SSPVQIPPTPPFQERPAVSPVNSLEYGISRGFPPEPEEPEADQHFHFRHTSYSSVTSDCD
TDGYLSPSSFQEGLEVTKGNTSSPPVPPSPLATATSATPTPPVKALRFPSSIAVTNSSEK
AAVSGPSSPISSPVDSYASDVTSGLSDGCEGQSERAGKSVARRTAGKLFRRRARARLRIT
GLSDKVDRVVECQLQTHNDKMVTFKFDLDGDSPEDISTVMVHNEFILPSEREGFIHQMRD
VIRRAESLMAKQSAGDQTNHTAARQPHLNSAAAILASQPNLHSLARTHSASSLPGETSTR
HAEDHLHHHFDQPCHLLSHHGVTLCVCVCVCLFFMLLHGSVGVPPRCGGNCLVYNSGFDG
RSHSKNVIIIIIVINNNFSSFFSLSLPGTSRPFQGHPAPPYQSDPMASLSKLAHLQQYPM
PYVATSTHMPFQYPPHPGSPQPSHPSLSGVHSNPTYSLSSPPSSCSSPGPLALDLLSPTS
DLNSPLTSPVLQNHTANMWPPQTPPLFSLANMLSMAMSMAHSFIPAQSLPSPLMQPLPSI
PGFPPQFAHHIQPQPGYPSVYAPQYAPPMQAEGFYQQVGPGGHPEAPNWEAMYGYTQKTH
SSMHNQAPMMPTHLLQMYANILQEMGEGRPPGHIDHLPKEFPGPQGYTQTFPISSLDQSG
LYRSSSSSSSSSSSGSLSSPRASPESTASSSSPRSLSPPPVAPETSSTSTHTPRESPVSA
EPKSTVTVGRFQVSPSKEFPTPVDISKTPPGSTPTPPASPDTPSTQVPSSSVCTSHENSP
QIEGRRASAGSEVTCINSDFSQHLHTDVPQDPSRSSAVATELNNSLGILPPVPPHEVSSL
QEYPSTPPESTTAVEAEEKQEVQRSGEEEPYDLHHHHQQQQQHHQQQQQKKRARKLDCDQ
SVMGTSVDSGLSIALDPEGSLWDGMMGSPPYPTPLNNLWMSYTRTSSYMSSDESESEDEE
MWDELQELREKHLCEVQSLQAVQKREIEELYERMGKVPPPCIVSPAAMLSSRQRRLSKGG
PFPSSRRNSLQRLDILPVTGIIRKNSLSGGSSSSSSSSQDRPAKGVTFAPELTRM
NT seq 4848 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatgctcaggtggagctgcctggacttggctttccgagtttacctgttgatcta
gaccctgagtgtgcagagagaaggtccatcaggaggaactcctatgttattcacaaactt
aatgttgacatcgagtctcagttttttaatggagcactgtcctggccctcggagaatgta
ctgtgcgagaacaggacagaagaagggaaggtggacacctgtccaccgtcaccttctccg
gtctccagtcccaagacccccaccccacagagctgctgttctccttcagaaaccccaggg
ccatggagggtctcggggcaagaccccagctcagactctgatcctgaagcagccaagccg
gggaaggtgaagccccggatggagagcaggtgggagctggaggagaaggaggacatggag
accaaagctgtggccacctcgccggacggacggtacctcaagttcaatgtggaaattggc
agagggtccttcaagacggtctacaaggggctggacacggagaccaccgtggaggtggca
tggtgtgagctgcagacgcggaaactgaccaaagcggagcggcagcgcttcagcgaggaa
gtggagatgctgaagaacctgcagcacccgaacatcgtccgcttctacgactcctggaag
tccactctgaagggacacaaatgcatcctgctggtcactgaacttatgacctccggcacc
ctcaaaacttatctgaagcgttttaaggagatgaagctgaagctcctgcagcgctggagt
cgtcagatcctgaaaggtcttcacttcctgcacacgcgtactcctcccatcatccaccga
gacctgaagtgcgacaacatcttcatcaccggacccacgggcagcgtgaagatcggtgac
ctcggactggctacgctaaagagagcatcgtttgctaagagtgtaatcggaaccccggag
ttcatggctccagagatgtacgaggagaagtatgatgaggcggtcgatgtttatgcgttt
ggaatgtgcattttggagatggctacatcagaatacccgtactctgaatgccagaatgca
gcacagatctatcgcaaagtcaccagcggaatgaaaccagacagcttctacaaagtgaaa
gtgcctgagctgaaggagattattgaagggtgtattcgtatgaacaaagatgaaaggtac
accattcaggacctgctggagcacaccttcttccaggagcacaatggtgtccacgtggag
ctggcggaggaagacgacatggagaagtccagtctgaagctgtggctgcgaatggacgac
accaagaagcttcatgggaagtacaaggacaacaacgccattgagttcctgttcgagctg
tacaaggacgtgccagaggaagtggcgcaggaaatggtggtgctgggatttgtatgcgaa
gcggactacaagctggtagccaaggccatgcgggaccgagtcacggccattaagcgccag
cgggaaaggcagcgtcggctggctgaggagcagaagaagaggaagcaggaggtggcaatc
gaggaggagcttgaacctccctcgccgaagcccgttagccgagcccccgatagcctagcc
tcctctcctgttcagatcccgcccactccaccttttcaagagcgtcctgcggtctctcct
gtaaactccctggagtatggcatcagcagggggttcccaccagagccagaggaaccagag
gctgaccagcacttccacttccgccacaccagctactcctcagtgacctcggattgcgat
acagacggctatctgagtccctccagcttccaagaagggctcgaggtgactaagggtaac
acaagcagccctcctgttccacccagtccattagccacggccacatcagccacgcccact
ccaccagttaaggctctccgttttccttcaagcatcgctgtgactaacagctctgaaaaa
gcagcagtctcaggaccttctagccccatctcctcacctgtggacagctatgcttcagac
gtcacctcaggcctgagtgacggctgcgagggccaatcagagagggctggtaagtcagtc
gctcgacggacagcaggaaaactcttcaggcgaagagctcgagctcgtctgcgcatcaca
gggctgtctgataaggtggaccgtgtggtggagtgccagcttcagacccacaatgataag
atggtcaccttcaagtttgacctcgatggagacagccctgaggacatctccactgtgatg
gtacataatgagtttatccttccgtctgagcgagaaggcttcattcatcaaatgcgtgat
gtcatcaggcgggcggagtctctaatggccaaacagtcggcgggtgaccagaccaatcac
acagcggctcgtcagccacacctcaacagtgctgcagcgattttagcatcgcagcccaac
ctccacagtctggctcgaacacactccgcctcctctctgccaggtgagacctccacacgg
cacgctgaggaccacctgcaccatcactttgatcagccatgccacttactgtcacaccat
ggagtgacactgtgtgtgtgtgtgtgtgtgtgtctcttcttcatgcttctccatggttcg
gttggtgttcccccacgttgcggaggcaattgtctggtttataactcaggatttgacgga
agaagtcacagtaaaaacgtcattattattattattgtaattaacaacaatttttcttct
tttttctctctctctcttccaggaacctcccgtccatttcagggccacccggctccgccc
taccagtcggaccccatggcgtccctctctaagcttgcccacctgcagcagtatccaatg
ccctacgtggccacctccacccacatgcccttccagtacccgccccatcccggctccccc
caacccagccatccctcactctccggggtccacagtaaccccacctactccttgtcgtca
ccaccttcttcatgctcttcaccgggccccctcgctctagacctcctgagcccaaccagt
gacctcaacagccccttaacctctcccgtccttcaaaaccacacggccaacatgtggccg
ccgcaaacccctccccttttctctctagccaatatgctgtccatggccatgagcatggcg
cactctttcatccctgcccagagtctaccgtcccccctgatgcagcctcttccctctata
cccggctttcctcctcagtttgcccaccacatccaaccacagcctgggtatccatcagta
tacgcgccgcagtatgctccgcccatgcaggccgagggcttctaccagcaggttggtcct
gggggtcacccggaagctccgaactgggaggccatgtatggttatacacagaagacacat
tccagcatgcacaatcaagcaccaatgatgcccacgcaccttctgcagatgtacgccaac
atcctacaggagatgggagagggcagaccgcctggacacatcgatcatctcccaaaagag
ttccccggccctcaagggtacacacagacgttcccaatatcttcactggaccagtcaggc
ctctatagatcctcctcgtcatcctcctcctcgtcatcatctgggtcattgtcttcaccc
agagcgagtccagagagcacagcctcgtcctcaagtccaagatcgctctcacccccgcca
gtggctccagagaccagcagcaccagcacacacacgcccagagaatcccccgtcagcgcc
gaaccaaagtccacagttacagtcggacgcttccaggtttccccctcgaaggagttccca
acaccagtggacatcagtaaaactccacctggatccacacctacacctcccgcctcaccc
gacactccatccacacaagtgcccagctcttctgtttgcacttcccatgagaactctcca
cagatagagggaagaagagcctcagcggggagtgaagtcacctgcataaactctgatttc
tctcaacacctccatacagatgttcctcaagacccgtctagatcctcagctgtagctact
gagctaaataactccttagggatcttaccgcccgttcctcctcatgaagtttcctccctc
caggaatatccttccactccgcctgagagcacgacagcggtggaagctgaggagaaacag
gaggtgcagcgtagtggtgaagaggagccgtacgaccttcaccaccaccatcagcagcag
cagcagcaccatcagcagcagcagcagaagaagagggcccgtaagcttgactgtgatcag
tctgtgatggggacgtcggtggacagcgggctttccatcgctctggatccggaggggagt
ctgtgggacgggatgatgggcagccctccgtatcccacccctctcaacaacctgtggatg
agctacacccgcacctcctcctacatgagcagcgatgagtcagagagcgaagacgaggag
atgtgggacgagctgcaggagctgagagagaagcacctgtgtgaggtgcagtctctgcag
gcggtgcagaagcgggagatagaggagctgtatgagaggatggggaaagttcctcctccc
tgcatcgtgtctccggcggccatgctgtccagccggcagcgtcgactctctaaagggggg
cctttcccttcctctcgcaggaacagcctccagagactggacatcctcccagtcacaggg
atcataaggaagaactctctgagtggaggaagcagcagcagcagcagcagttcacaggat
cgacccgccaaaggggtgacctttgcccctgaactcaccagaatgtaa

DBGET integrated database retrieval system