KEGG   Astyanax mexicanus (Mexican tetra): 103046979Help
Entry
103046979         CDS       T05042                                 

Gene name
pik3c2b
Definition
(RefSeq) LOW QUALITY PROTEIN: phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00562  Inositol phosphate metabolism
amex01100  Metabolic pathways
amex04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103046979 (pik3c2b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    103046979 (pik3c2b)
Enzymes [BR:amex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     103046979 (pik3c2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PX C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 103046979
NCBI-ProteinID: XP_022538577
Ensembl: ENSAMXG00000010065
Position
22
AA seq 1530 aa AA seqDB search
MSAAQTHSDSEQRWGCLESLGLSPRELVLAEALQMEYDALSRLKQDKGPAETGTPESSKS
STTRTERPLPRPLPSPPGGNLHHGLSGSDPMLNLIQPGVSNPSRSFYSKEPLYILDSQGK
DDYEGTSRMLSKGLPPPDEPPPAVPPRNPIPQPDSFMAQRGSAPRDVNLFTPDVDQPKLP
SGDTMNYDNLNDSLMRLNGDWPSSPRARRAYSEQSGKPVARSKTLPPQVPPRTYIPGQMS
TRSNRRVSADPVSLGSRLNGFGYELFQVSEERDEEVAAFCHMLDVLRSAYPCSERSKNAG
FVWSPSVAQEELQQGLGVSIKVTVVSEHFREPLIFTCDGSSTIDLLIYQTLCYAHDDLDM
IDVSDYVLKICGQEEYLNNSQTLAGLEYIQHCLKFDCDIWLFLARRSSVNTELARTLDDD
ETPSTMNHSILLQERPIKQTVTREALTLLLDTFHNEAESFVLSEVELPLHVERLVQSVKA
LCSSLAAVETPEITSALNQLPACPCRLQPRVQKDVSVLARRETRENIVERLTAAILDLVE
LYCSTFNANFHTVPPSSRPTAPIQEAGMVTNVLSFSVHAAHRIPITWAASYEGFFLSCSL
THGGDELCAPQHTSKQSVSKYLFHLVVWEQRICFPVQINQLPRESQLTVTLYAAPLPPPG
GAEEKSKQKTRSMEALGWVTMPLFNFRHVLTCGRKLLGLWPSTPGSGNARSSTPNFSQPD
SVILQVDFPTSSFEVRFSTPPPAEFSPQYDFSRLDQSSQKQLQDVLHKKSLFWLTPEDRR
LLWEKRYFCHSESSRLPLILASAPSWEWACLPDIYALLHQWICTNHLDALGLLHSTFPDQ
ECRRTAVKWMDTISDPELLDFLPQLVQALKYECYLDSPLVRFLLRRAIGDVRIAHCLFWL
LKDALQDSQFSVRYQHLLAALLCCSGHGLRDEFDRQCWLVNILAKVAQRVRDTSPSSRQA
VLREGLDEVKQFFCINSSCRLPLNPGLLVKGINIQSCSYFNSNAVPLKLSFQNMDLQGDN
INVIFKSGDDLRQDMLTLQVIRIMNKIWIQEGLDMRMVIFRCFSTGSSRGMVEMIPNAET
LRKIQVEHGVTGSFKDRPLADWLQKHNPTEDEYEKAVENFIYSCAGCCVATYILGICDRH
NDNIMLKTSGHMFHIDFGKFLGHAQMFGNIKRDRAPFVFTSDMAYVINGGDKPSSRFHDF
VDLCCEAYNLIRKHAHLFLNLLGLMLSCGIPELSDLEDLKYVYDALRPHESEADATMYFT
RLENNHVLCMLLVRLFQAYVVRVEREGQQGASLVQRSFEEFHELHDKLRLVFPSSKLPSF
PSRFMIGRSRGEAMADRRKDELNGYVWHLIHASPEVAQSDLVYTFFHPLPRDERPVGTAV
NTLNNKPAELPWAPIPGKVAGEVKLSISYKSDKLFIMVMHIRGLQSLQDGXDPDPYVKLY
LLPDPQKTSKRKTKAARRTCNPTYNEMLVYDRIPRGDLNQRSIHLRVLGEGAFWENTLLG
EAFIPLKNLTPGQHWVDWHQLSLGGSEASR
NT seq 4593 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcggcacagacacacagcgacagcgagcagcgctggggctgcctggagtcgcta
ggcttgagtcccagggagctggtcctggctgaagctctgcagatggagtacgacgccctg
tctcgcctcaaacaggacaagggaccagctgagactggaacccccgagagcagtaaatct
agcactactaggactgagcgccccctgccaagacctctgccaagcccacctgggggtaac
ttgcaccacggtctgtcagggtccgatcccatgctcaacctcatccagcctggggtatcg
aacccgtcaaggtccttctacagcaaagagcctctttacatcttggacagccaggggaaa
gatgactacgaggggacgtcacgaatgctgtcaaagggcctgccacctcctgacgaacct
ccaccggcagtgccccctcggaaccccatcccccagcctgattccttcatggcccaaaga
gggtcagctcccagggacgtgaacctattcacccctgacgtggaccagcccaagcttcct
tctggagatactatgaactatgataacctgaacgattctctgatgaggctcaacggggac
tggccttcttcgccgagggcacggcgagcgtacagcgaacagtcggggaagcctgtggct
cggagtaagaccctacccccgcaggtgcctcctcgcacctatattcctgggcagatgagt
accagaagcaaccgcagggtgtcagctgacccggtctcactgggttctagactcaatggc
tttgggtacgagctcttccaggtgtctgaggaacgtgatgaagaggtggctgccttctgt
catatgctggacgtgttgcgttcggcgtacccgtgcagcgagcgctctaagaacgcgggc
ttcgtgtggagccccagtgtggcgcaggaggagctgcagcaggggctgggggtcagcata
aaggtcacagtggtcagtgagcacttccgggaacccctcatcttcacatgtgatggctct
tccaccattgacctgctgatataccagaccctatgctacgcccatgatgacctggacatg
atcgacgtgagcgactacgtgctaaaaatctgcggacaggaagagtatctcaacaattct
cagaccctcgctggacttgagtatatccagcattgcctgaagttcgactgcgacatctgg
ctattcctcgccagaaggagttcagtcaacacagagctagctcgtacgctggacgatgat
gagacgccgtccaccatgaaccacagcatcctcctgcaggagaggcccattaaacagact
gtgaccagggaggcgctgactctgctgctggacacctttcataacgaggccgagtccttc
gtactgtctgaggttgagttgccattgcatgtggagcgtcttgttcagtcggtgaaggcc
ctgtgcagctcgctagctgcagtagaaacgcccgagattaccagtgcccttaaccagcta
cccgcctgcccctgccgactgcagccccgggtacagaaggatgtcagcgtgttggcgagg
agagaaacacgagaaaacatcgttgagaggttgacggcagccatcttggatctggtggag
ctctactgcagcacgttcaacgccaacttccacacggtgccgcccagcagccggcccacg
gcgcccatccaggaggcgggcatggtcaccaacgtgctgtcgttcagcgtccacgccgcc
caccgcatccccatcacctgggctgccagttatgaaggattttttctctcctgttctctc
acccatgggggggatgagctctgcgccccccagcacaccagtaaacagtccgtcagcaaa
tatctcttccatctggtggtctgggagcagagaatttgctttccagttcagataaaccag
ctgccgcgggagtcacagctaacagttaccctttacgccgctcctctgccgccccctgga
ggagcggaggagaagagcaagcagaagactcgcagtatggaggctctaggctgggtcacc
atgccactcttcaatttccgacatgttctgacctgtggcaggaagctgttgggtctgtgg
ccttcgaccccaggcagcggcaacgcccgctccagcacgcccaacttcagccagccggac
agcgtcatcctgcaggtggattttcccacctcctcgttcgaggtgcgttttagcaccccc
ccaccggccgagttcagcccccagtacgacttctctagactggaccagagcagccagaag
cagctgcaggatgtcctgcacaagaagtccctgttctggctgacccctgaagaccggcgt
ttgctgtgggagaagcgttacttctgccactctgaaagcagccgtctgcccctcatcctc
gccagtgcgcccagctgggagtgggcatgcctgcccgacatctacgccctcctgcaccag
tggatctgcaccaaccacctggacgccctgggcctactgcactccacgtttcctgatcag
gagtgcaggcgcacagctgtcaagtggatggacacaatctctgaccctgagctgctagac
ttccttccacaactagtgcaggcgctgaagtacgagtgttatctggacagtccgctggtg
cgcttcctgctgagaagagccatcggagacgtacgcatcgcccactgtctgttctggttg
ctgaaggacgctctgcaggactcccagttcagcgtacgttaccagcacctgctggccgct
ctgctctgctgctctggtcacggcctgcgggacgagttcgaccgccagtgctggctggtc
aacatcctggccaaggtggcccagcgtgtccgagacacctcaccttcctcccgacaggct
gttctgagagaggggctggatgaggtcaagcagttcttctgcatcaacagcagctgccgc
ctccccctcaaccctggcttgcttgtcaagggcattaatatacagtcctgctcctacttc
aactccaacgctgtgcccctgaagctctccttccagaacatggatctgcaaggagacaac
attaacgtcatcttcaagtcaggagatgacctgcggcaggacatgctgacactgcaggtc
atccgtatcatgaacaagatctggatccaggaggggctggacatgaggatggtcatcttc
cgctgcttctccactggaagcagccgaggtatggtggagatgattcctaatgcagagact
ctgaggaagatccaggtagagcacggagttaccggctcctttaaagaccgtcctctggcc
gactggctgcagaaacacaaccctactgaggacgagtacgagaaggctgtagagaacttt
atctactcctgtgcaggctgctgcgtagccacctacatcctgggcatctgcgaccgtcac
aacgacaacatcatgctgaagaccagtggccacatgttccacattgactttggcaagttc
ctgggccacgcgcagatgttcggtaacatcaaacgggaccgggctccatttgttttcacg
tctgacatggcgtacgtgatcaacggtggagacaagccgtccagccgcttccatgacttt
gtggacctgtgctgtgaggcttataacctcatcaggaaacatgcacatctcttcctcaac
ctgttgggcctgatgttgtcctgtggcattcctgagttgtctgatctggaagacttaaaa
tatgtctacgatgctctgcgaccacacgagtccgaggcagatgccaccatgtactttacc
aggttagaaaacaaccatgttttatgtatgctgttggttcgtctgtttcaggcgtatgtg
gtgagagtggagcgtgagggccagcagggggcgtcgttggttcagaggagttttgaggag
tttcatgagctgcatgataaactgcgccttgtcttcccctcttctaaactacccagcttt
cccagccgcttcatgattggccgctctcgtggggaggccatggcggaccggaggaaagat
gagctgaatggatacgtgtggcatctgatccacgcatcgcctgaagtggctcagtctgac
ctggtctacaccttcttccatcccttaccgagagatgaacggccagtgggaactgctgtg
aatacactaaataacaaaccagcagaattaccctgggcgccgatacctggtaaagtagca
ggggaagtgaagctctctatttcctacaaaagtgacaagctcttcattatggtcatgcac
atacgaggcttgcaatctttgcaggacggancggatccagatccatatgtcaaactttac
ttactccctgatccccagaaaaccagcaagaggaagaccaaggcagctcgccgcacctgc
aaccccacctacaatgaaatgctggtgtatgacaggattccacgaggggatttgaaccag
aggtcaatccatctccgagtgctgggggagggagcgttctgggagaacactctgctgggc
gaggccttcattcccttaaagaacctgacgcctggccagcactgggtcgactggcaccag
ctgagcttgggtggctctgaggctagccgctag

DBGET integrated database retrieval system