KEGG   Astyanax mexicanus (Mexican tetra): 103047214
Entry
103047214         CDS       T05042                                 

Gene name
aff3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
KEGG Orthology (KO) [BR:amex00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:amex03021]
    103047214 (aff3)
Transcription machinery [BR:amex03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     103047214 (aff3)
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int PH_12
Other DBs
NCBI-GeneID: 103047214
NCBI-ProteinID: XP_007255638
Ensembl: ENSAMXG00000005439
Position
19
AA seq 1191 aa
MTHSWPSQQPPGGGGTERFLYSDSKEGKRHSSQHKHVRDNASFRMPRVAPHKSMLADDLK
LSSDEDDGDKGHQQISSWADHHNLSGQRTHTHGGRARHSSSGSSGSDSSSESESSSQRSL
SPSPREHSQPGAASQAQPGTCSKEDPSFTHWQLNTWLEKVQRNRHSVDHDLGGGQSSSVT
FDSGRGPSPGRYWERDSNPVARQDRSPSQSPVPSPRFDYSPRHSPRSSPGYSPCPSPGNS
PVPSPVPSVCPSPGASLRGSRSPSPLPPHPPKSPSPTVVSAPAPQRLNSYPQGSTHHQES
PRRPTQPTHTSSPVRQPKVRPWVPPDHNTERITDSRLSALQHHHSKHKETPHRPKTQSID
SRIKSRSSPVPNSDPQHHSQASSKPHHSPKPKARQLSSTDPNTERSHSHRPGDPRSKFNQ
NSNSKPKHSPASKSKHLVPSESSSGSFHSSSSRPPPRPDPQTSARPNSKPNSRRSPSPKP
NPKSREAPAPNARPSQKEHKRREREQEGHGHGKAQGGPQAQAAEAQRQGRLAEEQLIRRR
WVRSSEDEEEEDEERSRRRREGEERERKRRRRKEPNAEWKAVQPKQRPHTNSQHHQQSER
SNGQEREEQRTKKRRRSSEESSHAGVIDSNPSPPLSPPSPSQVVRPPRPPSSSSSSSSSS
SSSSSSSSESDSEPSLPQNVAKVPADSTSSKRPAEKKRRHHDSRPSETRSSVADPSRTSE
TSPDEGQQRRRKHKLYTLVPFGRTEKSTAYSHRGLRNLVVKIDLSLLARVPSASEVSQRR
SSSSSSSSLPAKTKEKASMRHLYQQEQEPGDARCKRKAENGEAQRDSKRSHFHTDKPPAP
SHSASGEHQESRSSSKQNGHHEDYFYTKRPLSPLSPPSAVKTQHADQQTTHPQRDSTVKK
SQMPRAQPKIEAECTGAPGNMQPPSGSWVPSTNQPAYYRGTVPYTDVSHHAEYYMHEAKR
LKHRADAMVDKLGKAVNYVDAALSFMECGKAMEEGPLEAKSPYTMYAETVELIRYAMRLK
SHTGPGARQEDKQLAVLCFRCLALLYWQMFRLKKDNALKYSKALLDYFKSSPKVPHTGPT
WNDATKGIVPPTCKSPVGLIGSQPGSSPPSPFINIPHRIHQMAANHLNITNSVLYSYEYW
EVADTLAKENKEFFNYLNTLTGPLTLHSSMAHIVQYTRQGLQWIRISANLS
NT seq 3576 nt   +upstreamnt  +downstreamnt
atgacccactcctggccttcccagcagcccccagggggagggggcactgagcgatttctg
tattcggattccaaggaggggaaacgacacagctctcagcataaacacgtgagggataat
gcatctttcaggatgccacgtgtggcccctcacaaatccatgctcgctgatgacctgaag
ctcagcagtgacgaggatgacggtgacaaggggcatcagcagatttcttcctgggctgat
catcacaacctgtcggggcagcgcacacacacacatggcgggagggcgagacattccagc
tcgggctcctcaggatctgattcctccagtgagtcagagagcagtagccagcggtcgctc
agcccgagcccacgagagcacagccagcctggagcagccagccaagcacagcctggcacc
tgcagcaaagaggacccatccttcacacactggcaactgaatacgtggcttgagaaagtt
caaaggaaccgacactcagttgaccacgacctgggaggaggtcagagctccagtgtgact
tttgactctggtcgaggaccatctccaggaaggtactgggagagagactccaaccctgtg
gcaagacaggaccgcagcccaagccaaagccctgtccccagccccaggtttgactacagc
ccgaggcacagtcctcgttccagccctggatatagcccttgtccaagtccaggaaacagt
ccagtgccaagcccagtaccaagtgtttgccccagcccaggtgccagcctaagaggaagc
agaagccctagccctttaccccctcacccgccgaaaagccctagtcctactgttgtttct
gctcctgcccctcaaagactaaactcttatcctcagggttctactcatcaccaggaaagc
cccaggcgtcctacacaaccaacgcatacctccagtcctgtgcgtcagcctaaagttagg
ccatgggtgcctccagaccataacactgaacgtattactgactctagactatctgctctc
cagcaccatcattccaaacataaagagactccacacaggcccaaaacccagagcattgac
tctagaatcaaatccaggtcaagtcccgttccaaactcagatccacagcatcactctcag
gccagctccaagccacaccacagtcctaaaccaaaagctaggcaattgtcttccactgac
cccaatactgagcgtagccatagccatagacctggtgatcccaggagcaaatttaaccag
aattcaaactccaagccaaaacacagccctgcatccaaatccaagcacttagtcccctct
gagtcaagcagtggctctttccacagttccagctctaggcctccacctagacctgaccca
cagacttcagctaggccaaactcaaagcctaactctagacgcagccctagtccaaaaccc
aatccaaagtccagagaggcaccagcgcccaacgccaggccatctcagaaggagcataag
cgcagagagagagagcaggagggtcacggtcacgggaaggcacagggtggtccccaggcc
caggctgcagaagctcagagacagggtaggctggcggaggagcagttgatccggcgccgc
tgggtccgcagctctgaggacgaagaagaggaggacgaggagaggagtagaagaagaaga
gaaggtgaagagagggagagaaagaggaggaggaggaaggagccaaatgctgaatggaag
gcggtacagcccaagcagagacctcacaccaacagccagcatcaccagcaaagcgaacgc
agcaacggacaagagcgtgaggagcagaggacgaagaagaggaggagaagcagtgaggag
tcctcccacgcaggagtcatagactccaacccttctcctccactctctccaccctccccc
tcacaggtcgtccgccctccacggccaccttcttcctcttcgtcctcttcttcttcctcc
tcttcttcttcgtcgtcttcttcagaatcagactctgagccaagtttgccccagaatgtc
gccaaagtccctgcagactctacatccagcaagcgaccagcggaaaaaaaacggagacat
cacgactcgagaccctcagagacgaggtccagtgtagcagacccctccaggacaagtgaa
acatctcctgacgaaggtcagcagcgtcggagaaaacataaactttacaccttggtgcca
tttggccgcacagagaagtccactgcttactcacaccgaggactgaggaatctagtagtg
aagatagacctctcacttttagccagagttcccagtgctagtgaagtctcgcaaagacgt
tcttcatcttcatcctcctcttctttgccagctaaaacgaaagaaaaagcatccatgaga
catctgtaccagcaggagcaggagcctggagatgccaggtgtaaacggaaggctgagaat
ggagaggctcaaagagacagtaagagaagccattttcacacagacaaacccccagctccc
tcacactcagccagcggtgaacaccaagagagccgatccagcagcaagcaaaatggacat
catgaggactatttttacaccaagaggccactgtcgccactctctcctccatctgctgtg
aagacgcagcatgcagatcagcagaccacacacccccagagagactccacagtaaaaaaa
tcacagatgccaagggctcagccaaagatagaggctgagtgtactggagcaccaggaaat
atgcagcctccatctggctcatgggtgccatctacaaaccagccagcttactacagagga
accgtgccttacactgatgtttcacaccatgctgaatactacatgcacgaggccaagagg
ctgaaacatcgagcagatgctatggtggataaactggggaaggctgtgaattacgtggat
gctgctctttcgtttatggagtgtggtaaagccatggaggaaggccctctggaggctaag
tccccttataccatgtatgcagaaactgtggagttaataagatacgctatgaggctaaag
agtcacacgggccctggagccaggcaggaggacaagcagcttgctgtactttgtttccgt
tgtcttgctctactgtactggcaaatgttccgactgaaaaaagacaacgccctgaaatac
tccaaagccctgctagactacttcaagagttctccaaaagtgcctcacacaggacctacc
tggaatgatgctacaaagggaattgtacctcctacttgcaagtcccctgttggtttaata
gggtcccaaccaggcagctctcccccctcccctttcattaacattccccaccgtatccac
cagatggcagcaaaccacctcaatattaccaacagcgtgctttacagttacgagtactgg
gaggtggctgacaccttggccaaggaaaacaaagagttctttaactacttgaacaccctc
actggaccactgactctgcacagcagcatggcccatatagtccagtacaccagacaggga
ctacagtggatacggattagtgccaacttgtcctaa

DBGET integrated database retrieval system