KEGG   Astyanax mexicanus (Mexican tetra): 103047716Help
Entry
103047716         CDS       T05042                                 

Definition
(RefSeq) potassium voltage-gated channel subfamily G member 2
  KO
K04901  potassium voltage-gated channel subfamily G member 2
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
KEGG Orthology (KO) [BR:amex00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:amex04040]
    103047716
Ion channels [BR:amex04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   103047716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 DUF4834
Motif
Other DBs
NCBI-GeneID: 103047716
NCBI-ProteinID: XP_007253122
Ensembl: ENSAMXG00000013826
UniProt: W5L313
Position
23
AA seq 533 aa AA seqDB search
MYQEVAFLAGNTDHQFTTFHFNPLKSPVETGAKKGIFYKRARQLPWPSEFQEEIWCQTAI
AHNTLSIDSNAIINVGGIRYSIPWSTLEEFPLTRLGKLRSCSSAEEIMDLCDDYDACCNE
FFFDRSPNAFRCIVTFLAAGKLRLLREMCALSFQEELMYWGVKEASLEWCCLKKLRLRQE
DQREHLQQEEEETEPVSPQPCEEVSEGQDKGYLTRCMNSLRDMVENPHSGLPGKIFASLS
VVFVAITAVTLCVSTMPDLREEEERGECSQRCYNIFVLETVCVGWFSLEFLLRFIQTQRK
CLFLSTPLNIIDVVAILPYYITLIVDSLSVGDQSTVSGNNYLEKVGLVLRVLRALRICYV
MRLARHSVGLQTLGLTIRRCTREFGLLLLFLCVAMALFSPLVFLAESEMGAKQEFTSIPG
SYWWAVISMTTVGYGDMVPRSIPGQVVALSSILSGILLMAFPVTSIFHTFSRSYLELKEQ
QNQTTNHKAHSQDSTKSQNSEDSQETDSSLHGIAENMAATTSEQHCRSAPMVK
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaggaggtggccttccttgctggcaacactgatcatcagttcaccacctttcac
ttcaaccctttaaaaagcccagtggagactggcgctaagaagggcatcttctacaagcgt
gccagacaactgccatggccttcagagtttcaggaggaaatttggtgtcaaactgccatc
gcgcacaacactctctcgattgacagcaatgctattattaatgtaggtggtattcgttac
agcatcccgtggtcgacgcttgaggagttccctctgacacgtctcgggaagctgcggagc
tgcagcagcgcggaggaaatcatggatttgtgtgacgactacgatgcatgctgtaatgag
tttttctttgaccgcagcccaaacgcctttcgttgcattgtgacatttcttgcagcgggg
aagctgcgactgctgcgagagatgtgtgctctgtcctttcaggaggagttgatgtactgg
ggtgtgaaagaggccagcctggaatggtgctgtctaaagaagctccggctcaggcaggaa
gaccagcgtgagcacttgcagcaggaggaggaagaaactgagccggtgtcgcctcagccc
tgtgaagaggtgtcagagggccaggacaaaggctatcttacgaggtgcatgaacagtcta
agagacatggtggagaacccacattcaggcctgccagggaagatcttcgctagcctgtca
gtggtgtttgttgccatcacagcagtcactctctgtgtcagtaccatgccggacctgagg
gaggaggaggaaaggggtgagtgctcccagcgatgctacaatatctttgttctcgagact
gtttgtgtgggatggttctccttagagttcctgctgcgcttcattcagacccagaggaaa
tgcctgttcctgagcactccactcaacatcattgatgtagtagctattctgccctactac
atcactcttattgtggactctctctcagtgggtgatcaatccactgtatccgggaacaac
tacttggagaaagtgggcttggtgctgcgggtcctgcgggcgctgcgtatttgctacgtg
atgcgattagctcgccactcggtgggcctgcagacgctggggctgaccatccgcaggtgc
acacgcgagtttggcctgctgctgcttttcttgtgtgttgccatggcactgttctcaccg
ctggtctttctggccgagagtgaaatgggggccaagcaggagttcaccagcatccctggc
agctactggtgggctgtcatttcgatgacaacggtgggctatggcgacatggtaccccgc
agtattccaggacaggtggtggcactgagcagcatccttagcggaatattactcatggcg
tttccagttacgtccattttccacaccttctcccgctcgtacctggagctcaaggagcaa
caaaaccaaactacaaaccacaaagcccactcgcaggacagcaccaagtcccagaacagt
gaagactcgcaggaaacggacagctcgctccacgggattgctgaaaacatggctgccacc
accagtgagcagcactgcagatccgcacccatggtgaaatag

DBGET integrated database retrieval system