KEGG   Astyanax mexicanus (Mexican tetra): 107197753
Entry
107197753         CDS       T05042                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04080  Neuroactive ligand-receptor interaction
amex04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107197753 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107197753 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 107197753
NCBI-ProteinID: XP_015462639
Ensembl: ENSAMXG00000000238
UniProt: W5JY37
Position
24
AA seq 77 aa
MNVKILTLVIVLLVSLLCSACAGPMASTEHSKELEEVGSMRTPLRQTQARAGRSQRPSSW
RRRRPRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgttggtgattgtgctgctggtttctctgctgtgttcagcc
tgtgctggtccaatggcctccaccgagcatagcaaggagctggaggaggtggggagcatg
cggactccactccggcagacccaggcccgagccgggcggagccaaagaccctccagctgg
aggaggagacgccctcggcctcgcctgtcccacaagggacccatgccgttttag

DBGET integrated database retrieval system