KEGG   Astyanax mexicanus (Mexican tetra): 111190984Help
Entry
111190984         CDS       T05042                                 

Gene name
me2
Definition
(RefSeq) NAD-dependent malic enzyme, mitochondrial
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00620  Pyruvate metabolism
amex01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    111190984 (me2)
Enzymes [BR:amex01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     111190984 (me2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malic_M malic
Motif
Other DBs
NCBI-GeneID: 111190984
NCBI-ProteinID: XP_022520550
Position
Unknown
AA seq 582 aa AA seqDB search
MLCRLRVSVRPWVSVCRWAHTKEKGKPLMLNPHTNKGMAFTLKERQMLGLQGLLPPKIET
QDIQAMRFQRNLRKISDPLQKYIYLMGIQERNERLFYRVLMEDIEALMPIVYTPTVGLAC
TQYGHIFRRPKGLFISIMDRGHVRSILDNWPETNVKAVVVTDGERILGLGDLGVYGMGIP
VGKLCLYTACAGIRPESCLPVCIDVGTDNQTLLRDPFYMGLYRRRERSQAYDDLIDEFME
AVVQKYGQETLIQFEDFGNHNAFRFLKKYRHKYCTFNDDIQGTASVALAGLLAARRVVGK
PITDHTVLFLGAGEAALGIANLIVMAMMEEGVSQTEARSRIWMFDKFGLLVQDREQPTDS
NQEAFVHPSPGFGIKTFLDAVNILKPTAIIGVSGAGRLFTHDVIKTMGSLNERPIIFALS
NPTAKAECTAEDAYTLTQGRCLFASGSPFGPVSLEDGQILTPGQGNNAYIFPGVALAVIL
SGVRHISDTVFLEAAKTLAGQLTDEELSQGRLYPPLSNIREVSVQMAIKVMEYLYMKGMA
FQYPEPVDKEAYVRSTVWNTNYDSFLPDVYDWPGVSHTPLVD
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcagactcagagtgagtgtgaggccgtgggtaagtgtgtgtcgctgggcgcac
actaaagaaaaagggaaaccactgatgctcaacccacacactaataagggtatggcgttc
actctgaaggagaggcagatgttggggctgcaggggctcctccccccgaagattgagacc
caggacatccaggccatgcgcttccagaggaacctgcgcaagatctcagaccctctgcag
aagtatatctatctgatggggattcaggagcgtaatgagcgcttgttttatcgggtgctg
atggaggatattgaggctctgatgccgatcgtttacacgccgaccgtcggcctcgcctgc
acccaatacggacacatattccgccgacccaagggactctttatctctattatggacaga
ggacacgttcgctccatcctggacaactggccagaaactaatgtgaaggcggtggtggtg
acggatggggagcgtattctgggtctgggggatttgggggtttatgggatggggattccg
gtggggaagttgtgtttatatacagcctgcgccggaatccgtccagagagctgcttaccc
gtctgtatcgacgtcggcacagataaccagacgttactcagggacccgttctatatgggt
ctgtaccggaggcgggagcgctctcaggcgtatgatgatctgatagatgagtttatggag
gcggtggtgcaaaaatacgggcaggagacgctcatacagttcgaggatttcggcaaccat
aacgctttccgcttcctgaagaaatacagacacaagtactgcacctttaacgacgacatc
cagggtactgcgtcagtagctctggctggtctgttggcggcgcggcgtgtcgtggggaag
ccaatcactgatcacactgtactgtttctgggagcaggagaggctgcactgggcatcgct
aacctgatcgtcatggcgatgatggaggagggcgtgtcacagactgaggctcgcagcagg
atctggatgttcgataaattcgggctcctcgtccaggatagagagcagccgactgacagt
aatcaggaggcgtttgtgcaccccagtcccggtttcggcataaaaacatttctggatgct
gtaaacattctcaaaccaacagccatcatcggtgtgtctggagcggggcggctcttcact
catgatgtcattaagacgatgggctctctgaatgaacgaccaatcatattcgccctcagc
aacccgacagccaaagcagagtgtactgcagaggacgcctacactctcacccagggacgg
tgtttgtttgcgagtgggagtccgtttggtccggtttctctggaggacggtcagattctg
actccgggtcagggcaacaacgcctacatattcccaggtgtggcgctggctgtgatcctc
agtggagttcggcacatcagtgacaccgtgttcctggaagctgcaaagactctggcgggt
cagctgactgatgaggagctgtctcagggccgactgtacccccctctctccaacatcagg
gaggtctctgtgcagatggccatcaaggtgatggagtatctgtatatgaaggggatggcg
tttcagtatccggagccggtggataaagaggcatacgtcaggtcgacggtttggaacacc
aactacgactccttcctgcccgacgtctacgactggcccggagtctcacacactcctctg
gtcgactga

DBGET integrated database retrieval system