KEGG   Astyanax mexicanus (Mexican tetra): 111191331Help
Entry
111191331         CDS       T05042                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111191331
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:amex04030]
    111191331
G protein-coupled receptors [BR:amex04030]
 Rhodopsin family
  Lipid
   Leukotriene
    111191331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 111191331
NCBI-ProteinID: XP_022521671
Position
Unknown
AA seq 302 aa AA seqDB search
MQLFNSSSISPPNSTTWSQANLVSSVLMGFFCAVGVPGNIAVMVIIIRWFKKDNFTVHLM
LNLAASDILCLMTLPVWMYNQLFTWSIGRSLCKFFISLVYSSASASLMTVTMISVHRYVQ
VCCPEKWSKLGKSGEKLLLFTIWVLGFGFSVPAMFTREIIFNGSKKECGIITSPDEYRLI
VAVLETLLAFVFPLSIMITSYYRLHRRATQGALFRSRTRLTRTVTGIVVMTFIFSSPCHV
INLVEIFGIVLKHSYPGLLDELLKFKNTVGDVAVSFTFISSCINPLLYAFASRSLQQNSE
SN
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcttcaacagcagcagcatcagtcctcccaactccacaacctggagccaagcc
aacctggtgagttcggttctgatgggcttcttctgcgctgttggagttcctggtaacatc
gccgtgatggtgatcatcatccgatggttcaagaaggacaacttcaccgtgcacctgatg
ctgaacctggcggcgtctgatatcctgtgtctgatgaccctgccggtgtggatgtacaac
cagctcttcacctggagcatcgggaggtccctctgcaagttcttcatctcactggtgtac
agcagtgcgtccgccagcctgatgaccgtcaccatgatcagtgttcaccgatacgttcag
gtttgctgtcctgagaaatggtccaaactgggcaaaagtggtgaaaaactactgttgttc
actatttgggttctgggatttggtttctcagtcccggcgatgttcaccagagagatcatc
ttcaacggatcaaagaaggaatgtggaataatcacgtcaccagatgaatacaggctcatc
gtcgctgttttagaaactctgctggccttcgtttttccgttatccatcatgatcacctcc
tattatcgtctccacaggagagcgacccagggggcgctgttccgcagccggaccagactg
accagaacggtgaccggtatagtagtgatgaccttcatcttctcatcaccctgtcacgtg
atcaatttggtggagatctttgggatcgtattgaaacactcttatccaggattgttggac
gagcttctaaaatttaagaatacagtgggagacgttgctgtgagttttaccttcatcagc
agctgcatcaatccactactctacgctttcgcttcacggagcctccaacaaaattcagaa
tcaaactag

DBGET integrated database retrieval system