KEGG   Astyanax mexicanus (Mexican tetra): 111191620Help
Entry
111191620         CDS       T05042                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: arylamine N-acetyltransferase, pineal gland isozyme NAT-10-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00232  Caffeine metabolism
amex00983  Drug metabolism - other enzymes
amex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    111191620
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    111191620
Enzymes [BR:amex01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     111191620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 111191620
NCBI-ProteinID: XP_022522860
Position
Unknown
AA seq 272 aa AA seqDB search
MDLKGYFKRIGFSGLYDKADLDTLCTIHKLHVMTIPFENLSLHCGEKNTMDLKVIYEKIV
CEHRGGWCCESNLLFSWVLKEMGYTFTTLGAKVFSMVKQEYSTMDMHLIXDVSFGVSRQI
WWPLEIIAGKDQAQPPGVFRLVNDGDRWILEKTGRKPLVQNEAFAKSSLVDKFGTQPVFS
FSLTPRAADHFLETSEYLQTSPESVFTQKSICSLQTANGFRSLIGWTLEVTFNPEEDRDI
YEMRDIPDSEIETVLKDRFNLTLASKLTPIIK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggatctgaaaggatactttaaaaggattgggttttctggtctgtatgataaagctgat
ctggacacactgtgcaccatacacaagcttcatgtgatgactattcccttcgagaacctc
agtctccactgtggagagaagaacacaatggacctaaaggtcatctacgagaagattgtg
tgtgaacatcgtggaggttggtgctgtgaaagcaacctgctgttctcctgggtgctgaaa
gagatgggttatacattcaccacactgggggccaaggtcttcagcatggtcaaacaggaa
tacagcaccatggatatgcacctcatcnatgacgtgagcttcggtgtatcacgtcaaatt
tggtggccattagagataatcgctggcaaagaccaagctcagcccccaggggtgttccgc
ctagtgaatgacggtgataggtggatcctggagaagacaggaaggaagccattggtccag
aatgaggcctttgccaagtctagcctcgttgacaagtttgggacacagcctgtgttcagc
ttctcattaacaccacgtgctgcagaccactttttggagacatcagagtacctccagacg
agtcctgagtctgtgtttacccagaaatccatctgttccctgcagacagccaatggcttc
agatctctgattggttggacattggaggtcacatttaatcctgaggaagacagagacatc
tatgagatgagggacattccagacagtgaaatagagactgtactgaaggacagatttaat
ctgactttggctagtaaactgacaccaataatcaagtaa

DBGET integrated database retrieval system