KEGG   Astyanax mexicanus (Mexican tetra): 111192910Help
Entry
111192910         CDS       T05042                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit-like
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04010  MAPK signaling pathway
amex04260  Cardiac muscle contraction
amex04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111192910
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    111192910
   04261 Adrenergic signaling in cardiomyocytes
    111192910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:amex04040]
    111192910
Ion channels [BR:amex04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   111192910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF4199 DUF716 DHHC Tetraspanin Orf78 SAPS
Motif
Other DBs
NCBI-GeneID: 111192910
NCBI-ProteinID: XP_022526899
Position
7
AA seq 352 aa AA seqDB search
MSVCGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVILPLNQTTHTHTSLHSGLWR
VCFLAGEEMGRCFTIEYVMPMSVQLTSESTVSVLKMIRSATPFPLVSLFFMFIGFVLNNI
GHVRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVLNRTKNNEAYFSYKYGWSFA
FAAISFLLTESAGVMSVYLFMKRYTAEEMYQPHPSFYRPQDDAEDAEEDAEDAADIEDAV
DADDDEDAVDEAEDADDDTEDDAEVDDEDDAEDDDEDDAEDAVMMLWMMLMMLRMLRIVW
MLTILVAVGDFEDTNDNGDDTEDNAEDANDNVCVDDADDAEDYVDADAVVLG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgtgcggtaggaaggcgctgactctgctgagcagtgtgtttgcagtgtgtggg
ctggggctgctggggatcgccgtcagcaccgactactggctctacctggaggagggggtc
atcctgcccctcaaccagaccacccacacccacacctccctccactccggcctctggagg
gtctgcttcctcgcaggggaagagatggggcgatgcttcactatagagtatgtgatgccc
atgagtgtccagctgaccagtgaatctacagtcagtgtgctgaagatgatccgctcagct
acgccgtttcctctggtcagtctgttcttcatgtttatcggcttcgtgctgaataacatc
ggacacgtccgcccccatcgcaccatactggccttcgtctcaggaatcttcttcatcctg
tcaggtctttctctggtggtgggtctggttctctacatctccagtattaatgatgaggtt
ctgaacaggactaagaataacgaggcgtatttcagctataagtacggctggtccttcgcc
ttcgccgccatctccttcctgctcactgagagtgccggggtgatgtcggtgtacctgttt
atgaagcgctacacagccgaggagatgtaccagccccacccgagcttctaccggcctcag
gatgatgctgaggatgcagaggaggatgctgaggatgctgctgatattgaggatgctgtg
gatgctgatgatgatgaggatgctgtggatgaagctgaggatgctgatgatgatactgag
gatgatgctgaggttgatgatgaggatgatgctgaggatgatgatgaggatgatgctgag
gatgcagtgatgatgctgtggatgatgctgatgatgctgaggatgctgaggattgtgtgg
atgctgacgatactggttgctgtgggtgattttgaggacactaatgataatggtgatgat
actgaagataatgcagaggatgctaatgataacgtatgtgtggatgatgctgatgatgct
gaggattatgtggatgctgatgctgttgtattgggctga

DBGET integrated database retrieval system