KEGG   Astyanax mexicanus (Mexican tetra): 111194996
Entry
111194996         CDS       T05042                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
KEGG Orthology (KO) [BR:amex00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:amex01002]
    111194996
Enzymes [BR:amex01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     111194996
Peptidases and inhibitors [BR:amex01002]
 Metallo peptidases
  Family M1
   111194996
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 111194996
NCBI-ProteinID: XP_022536468
Position
20
AA seq 930 aa
MSRIMLLLLSISLLLFLVPPLEALNPGNTTFSSLLWSMRLPDSVKPLHYDLLIHPNLTSL
SFSGAVQIQLDVLQETRHIFLHSKSLEISRALLLGSRYQHLLQVQESEAFEQIALSYENF
TFSTGLYVIRLEFSANLSESFHGFYKGTYRTSSGEVRTLASTQFEATHARSAFPCFDEPA
FKANFSIRVRREPRHISISNMPNLKTVELAGGLLEDQYDVTVKMSTYLVAFIVCDFLSIS
RRSQHGVEISVYTVPEKISQAEYALNTAVTLLDFYDDYFNIPYPLPKQDLAAIPDFQSGA
MENWGLTTYRESGLLFDPERSSTSDKLGITKVIAHELAHQWFGNLVTMQWWNDLWLNEGF
AKFMEFVSVNLTYPELQVDDYFLEKCFTAMGVDSLSSSHPISTPVENPAQIREMFDDVSY
QKGACVLNMLRDFLTPEVFKIGIIRYLKKHSYQNTVNSDLWYSLTNVCQSDDLDLGRLKE
DGFCSDSKTRTSASKWFMEDDLDVREIMDTWTLQEGFPLITVEVKGREVRLKQERFLKGA
ESANHPNFLWKVPLTYITSGSSSVQRFLLKTRHDVLYLPAEVEWVKFNVDMRGYYIVHYA
AGGWDALIRQLQLNHTVFSGNDRASLIHNIFQLVSIGKVPLDLALSLSQYLSSESEIMPV
TQGFSELVPLYKLMEKRDMAALENQLKGYLVNVFRRLIDAQSWSDDGSVSERMLRNYLLL
FACVRRLPACVGPAQRLFRQWKESDGALRLAADVRLVVYTEGARTEEGWDFLLEKHGSTM
YPSERSQIKAALSYSPLPHKLEWLMEKGLEGEILKTHELPSLIISVSKNPTAYRLAWDFL
TANWQKLVKKFDLGSSAISRMVVGVTNQYSTQEKLEEVQSFFGSLDESTGAGLRSIQQAL
QNIQENIRWMDQNVPVLQDWLNRHSTGPAL
NT seq 2793 nt   +upstreamnt  +downstreamnt
atgagcagaatcatgctgctgctgttgagtatctccctcctcctcttcctcgttcctcct
ctcgaggccctgaatcctggaaacacaaccttctccagtttactgtggagcatgagactc
ccggacagtgttaaacctcttcactacgacctgctgatccaccccaacctcacctccctc
agcttcagcggggcggttcagatccagctggatgttctgcaggaaacccggcacatcttc
ctccacagtaagagtctggagatctccagagctctgctcttaggatccagatatcagcat
cttctccaggtccaggagtctgaagcgttcgagcaaatcgcactgtcctacgagaacttc
acgttcagtacggggctgtacgtgatccggctggagttctcagccaacctgtcggaaagt
tttcacggcttttataaaggaacgtacagaacgagcagcggagaagtcaggactttggcc
tccacccagtttgaggcgactcacgctcgatctgctttcccctgctttgatgaaccagct
ttcaaagccaacttctccatccgcgttcgccgagagccacggcacatctctatatccaac
atgccgaatctgaagacggtggagcttgctggtggcctgctggaggatcagtatgatgta
acggtgaagatgagcacatatctggtggcttttatcgtctgtgatttcctgtccatcagt
aggcggagtcaacatggcgtggagatatcggtgtacacggttccggagaagatcagtcag
gcggagtacgctctgaacaccgcagtaactctgctcgacttctacgacgattacttcaac
atcccctatcctcttcccaaacaggatcttgctgctatcccagattttcagtcgggtgcg
atggagaactggggtttgacgacgtaccgagagtccgggctgctgtttgatccggaacgt
tcctccacctcagataaactgggaatcaccaaggtcatcgcccacgagctcgcccatcag
tggtttgggaacctggtgacgatgcagtggtggaacgacctgtggttaaatgaaggcttc
gccaagttcatggagttcgtctccgtcaacctcacctaccctgagctgcaagtggacgat
tacttcttagagaagtgtttcactgcgatgggcgtggactcattaagctcctcccacccc
atctctactcccgtggagaatccggctcagatcagagagatgtttgatgatgtttcatat
cagaagggggcgtgtgttttgaacatgctgagggattttttgaccccggaggtgtttaag
atcgggatcattcgttacctgaagaagcacagctaccagaacactgtgaactctgacctg
tggtacagcctgactaacgtgtgtcagtcggatgatttggatctcgggaggctgaaagag
gacggattctgttccgacagcaaaaccagaacatctgcctcaaagtggtttatggaggat
gatctggacgtgagggagataatggatacctggacgctgcaggagggatttcctctcatc
actgtggaggttaaaggtcgagaggttcgactgaagcaggagagattcctcaaaggggcg
gagtctgcaaatcatccaaacttcctgtggaaagtgcccttgacctacatcaccagcggc
tccagctccgtccagcgctttctgctcaaaaccagacacgacgtgctgtacctgccggcg
gaggtggagtgggtgaagtttaatgtggatatgagggggtattatatagtgcattacgct
gcgggggggtgggacgctctgatccggcagctgcagctcaatcacaccgtgttcagcgga
aacgaccgagccagtctcatccacaacatcttccaactcgtcagtattgggaaggttcct
ctggacctggctctgagtctcagtcagtatctgagctctgagagtgagatcatgccggtc
actcagggcttcagtgaactggtgccgctttataaactcatggagaaaagagacatggca
gctctggagaaccagctgaagggctacctggtgaatgtgttccggaggctgattgatgct
cagagttggagtgatgacggctcggtgtcagagaggatgctgaggaactacctgctgctg
ttcgcctgcgttcgccgcctcccggcctgcgtcggccccgcccagcggctcttcaggcag
tggaaggagtctgacggagcgctgaggttggcggctgacgtgcggttggtggtgtacact
gagggagctcgtacagaagaaggctgggacttcctgctggagaagcacggcagcaccatg
tacccgtctgagaggagtcagattaaagcagcgctgtcctacagccccctcccccacaag
ctggagtggctgatggagaaaggtctagaaggagaaatcctgaagacccacgagctcccg
tctctcatcatcagcgtcagtaaaaacccaacagcctacagactggcctgggacttcctg
acagctaattggcagaaactggttaaaaagtttgatctgggttcctctgcgatctcgagg
atggtggtgggcgtgaccaatcagtactcaactcaggaaaagctggaggaggtgcaatcg
ttcttcggttctctggatgagagcacaggggcggggctacgcagcatccagcaggccctg
cagaacatccaggagaacattcgctggatggatcagaacgttccggttctccaggattgg
ctgaaccgccacagcaccggaccggccctgtag

DBGET integrated database retrieval system