KEGG   Astyanax mexicanus (Mexican tetra): 111196603Help
Entry
111196603         CDS       T05042                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04010  MAPK signaling pathway
amex04260  Cardiac muscle contraction
amex04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111196603
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    111196603
   04261 Adrenergic signaling in cardiomyocytes
    111196603
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:amex04040]
    111196603
Ion channels [BR:amex04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   111196603
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716 Claudin_3 DHHC
Motif
Other DBs
NCBI-GeneID: 111196603
NCBI-ProteinID: XP_022541636
Position
Unknown
AA seq 289 aa AA seqDB search
MSVCGRKALTLLSSVFAVCSLGLLGIAVSTDYWLYLEEGIILPLNQSTEIRMSLHSGLWR
VCFLADSSPPERVLPTGEPGKEKGRCFTIEYIMPTNVHLTSDVTVSVLKMIRSATPFPLV
SLFFMFIGFVLNNIGHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKT
NEAYFSYKYGWSFAFAAISFLLTEAAGVMSVYLFMKRYTAEEMYRPHPGFYRPRLSNCSD
YSGQFLHPDAWTRGRSPSDISSEASLQMSSNYPALLKCPEYDQMSSSPC
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgtgtggtagaaaggctttaacgctgctgagcagtgtgtttgctgtgtgtagc
ctgggcctgctgggcatcgctgtcagcactgactactggctctacctggaggaggggatt
atactcccgctgaaccagagcacagagattcgcatgtccctccactccgggctctggagg
gtctgtttcctcgcagattcttcaccgcctgaaagagtgttacccaccggggaaccaggt
aaagagaagggacgctgcttcaccatcgagtacatcatgcccaccaacgtccacctaaca
tctgatgtcacagtcagtgttttgaagatgatccgctcagccactcccttcccgctggtc
agcctcttcttcatgttcatcggcttcgtcctgaacaacatcggacacatccgcccgcac
cgcaccatcctggccttcgtctctggaatcttcttcatcctctcaggtctttctctggta
gtcggtctggtgttgtacatctccagcattaatgatgagatgttgaacagaacaaagaca
aacgaagcctatttcagttacaagtacggctggtccttcgctttcgctgccatctccttc
ctcctcactgaggctgccggtgtgatgtcagtttatctgtttatgaagcgctacacagca
gaggagatgtaccgaccgcatccgggcttttaccggccgcgtctcagcaactgcagcgac
tactcgggccagttcctgcacccagacgcctggacccgcggccgcagcccctcagacatc
tccagtgaagcctcgctccagatgagctccaactaccccgccttgctcaagtgccccgag
tatgaccagatgtcatcctccccctgctga

DBGET integrated database retrieval system