KEGG   Anaplasma marginale Florida: AMF_043Help
Entry
AMF_043           CDS       T00855                                 

Gene name
rplT
Definition
(GenBank) cyanelle 50S ribosomal protein L20 (rplT)
  KO
K02887  large subunit ribosomal protein L20
Organism
amf  Anaplasma marginale Florida
Pathway
amf03010  Ribosome
Brite
KEGG Orthology (KO) [BR:amf00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AMF_043 (rplT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:amf03011]
    AMF_043 (rplT)
Ribosome [BR:amf03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AMF_043 (rplT)
  Bacteria
    AMF_043 (rplT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L20
Motif
Other DBs
NCBI-ProteinID: ACM48937
UniProt: B9KHH5
Position
complement(41831..42217)
Genome map
AA seq 128 aa AA seqDB search
MARVKRGVTARARHKKVVALAKGYRGRSKNCYRAALQRLEKALVYAYRDRRNRKRDFRRL
WIVRINAAARQWGIKYSQLMKGMALCGIELNRKMLAEMAVNDKAAFEKVVSAVAGTCGYA
CAVNQQDK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggctagggtcaaacgcggtgttaccgccagggctaggcacaagaaagttgttgcactt
gccaaaggttatagagggcgctctaaaaactgctacagagctgcgctgcagcggctggag
aaggctttggtgtatgcgtatcgggataggcgcaatcgtaagcgtgacttcaggcgcctg
tggattgtgcgcatcaacgctgcggcaaggcaatggggtattaaatactctcagctgatg
aagggtatggctttgtgtggtatagagctgaaccggaagatgctggcggagatggccgtg
aatgacaaggctgcctttgagaaggtagtaagcgctgtcgcgggtacctgtgggtatgct
tgtgccgttaatcagcaagataagtga

DBGET integrated database retrieval system