KEGG   Anaplasma marginale Florida: AMF_217Help
Entry
AMF_217           CDS       T00855                                 

Gene name
sdhD
Definition
(GenBank) succinate dehyrdrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
amf  Anaplasma marginale Florida
Pathway
amf00020  Citrate cycle (TCA cycle)
amf00190  Oxidative phosphorylation
amf00650  Butanoate metabolism
amf01100  Metabolic pathways
amf01110  Biosynthesis of secondary metabolites
amf01120  Microbial metabolism in diverse environments
amf01130  Biosynthesis of antibiotics
amf01200  Carbon metabolism
Module
amf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
amf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMF_217 (sdhD)
   00650 Butanoate metabolism
    AMF_217 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    AMF_217 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS DUF1980
Motif
Other DBs
NCBI-ProteinID: ACM49094
UniProt: B9KHY2
Position
248257..248607
Genome map
AA seq 116 aa AA seqDB search
MVVVLALMGGRSVYFWWMQRIAGLVMLPVPFLFAFFYRSYGFESVHAADYGFCASVSAIA
LLVAAFYHGVLGVQVVLEDYVHSEVLRAFMITFFRLFALVTVCAVTLAMLFGHNIR
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
ttggttgtagttctggctcttatgggtggaaggtctgtatatttttggtggatgcaaaga
atagctgggctggttatgctgcccgtaccgtttttgtttgcgtttttctaccgctcttac
ggttttgagtctgtccatgctgcggactatggcttttgtgccagcgtatctgctattgcg
cttcttgttgccgcgttttaccacggggttttgggcgtgcaggtggtcctggaggattac
gtccactccgaagttctgcgcgccttcatgattacattcttcaggctatttgccctggtc
accgtgtgtgcggtaaccttggcgatgctttttggacataacattaggtga

DBGET integrated database retrieval system