KEGG   Anaplasma marginale Florida: AMF_448Help
Entry
AMF_448           CDS       T00855                                 

Gene name
eno
Definition
(GenBank) Enolase 1 (2-phosphoglycerate dehydratase 1) (eno)
  KO
K01689  enolase [EC:4.2.1.11]
Organism
amf  Anaplasma marginale Florida
Pathway
amf00010  Glycolysis / Gluconeogenesis
amf00680  Methane metabolism
amf01100  Metabolic pathways
amf01110  Biosynthesis of secondary metabolites
amf01120  Microbial metabolism in diverse environments
amf01130  Biosynthesis of antibiotics
amf01200  Carbon metabolism
amf01230  Biosynthesis of amino acids
amf03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:amf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMF_448 (eno)
  09102 Energy metabolism
   00680 Methane metabolism
    AMF_448 (eno)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    AMF_448 (eno)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:amf03019]
    AMF_448 (eno)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amf04147]
    AMF_448 (eno)
Enzymes [BR:amf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     AMF_448 (eno)
Messenger RNA biogenesis [BR:amf03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AMF_448 (eno)
Exosome [BR:amf04147]
 Exosomal proteins
  Proteins found in most exosomes
   AMF_448 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MAAL_C MR_MLE_C
Motif
Other DBs
NCBI-ProteinID: ACM49308
UniProt: B9KIJ6
Position
542416..543789
Genome map
AA seq 457 aa AA seqDB search
MPVVDQMLYLSLLCLLFRKDCLFCPPLGVRAVVLSARSVAKINRVVARQILDSRGRPTVE
VEVLLSDGAVGRVSVPSGASVGKFEAVELRDGDQAKYAGHGVLKPVQRVNTTVADSLAGV
SPFDQRAVDEILLSLDGTKNKSKLGANATIGVSLAVAKAAADSVGIPLYKYLGGAVAREM
PLPLVNVINGGLHADNLLDFQEFMIVPVGAKTFADAAQICAEVFYKLKEVLKKMGHSTNT
GDEGGFAPNLEDNTDVLDVLVEAIEKSGYRASSDVALAMDVAASTFYDGTSYKFSGKCLT
SGELIACYEDMVSRYPIISIEDAMAENDIEGWKAVTKRLGDKIQLVGDDLFVTNPALIAN
GVENKLANAVLVKPNQIGTLTETIDAIRSAQRNNYNVIISHRSGETEDVTIAHIAVAANC
GQIKSGSFSRSERLAKYNELLRIEEDLGKSALLYNVI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgtagttgaccaaatgctctacctctcgttgctttgtttactttttcgtaaagat
tgtttattctgtccaccattgggtgtgagggccgttgtgctaagtgctagatcagttgcc
aagattaatagggttgttgcgcggcaaatcctagatagtaggggccgtcctacagttgag
gtcgaggttttgctgtcagatggtgccgtaggtagggtctctgttccatctggggcttca
gttgggaagtttgaggctgtggaacttagggatggtgaccaggccaagtatgctgggcat
ggggtactcaaaccggtgcagcgcgtcaacacaacggtcgccgattcattagctggagtc
tctcctttcgatcagagagctgttgatgaaattctgctgtcgctggacggaacgaaaaac
aagtctaaattgggtgcaaacgccactataggagtttcattggctgtggcaaaggccgct
gcagacagtgttggcatcccgttatacaagtatttagggggagcggttgcgagagaaatg
ccgctgcccctggtaaacgttatcaatggaggtctgcatgcggataacttgcttgatttt
caagaattcatgatagtacccgtaggtgccaagacatttgctgatgcggcgcagatatgc
gcagaggtgttttataagcttaaggaggtactcaagaaaatggggcactccactaatact
ggtgatgaaggaggttttgctccaaatttggaggataatacagacgtgcttgacgtctta
gtagaggcaattgaaaagtctgggtaccgagcctcttctgacgttgccctcgctatggat
gtcgctgcgtcaacattttacgatggcacatcatacaaattttccggcaaatgcctaacc
agcggtgagttaattgcatgctatgaggatatggtttcccggtaccctataatttccata
gaggatgctatggcggaaaatgacatagagggatggaaggcagttaccaagcgtctggga
gacaaaattcagttggtaggggatgatctttttgtgaccaatcccgccctcattgctaat
ggagtggaaaacaagttggctaatgcagttctggttaaacccaaccaaattggcaccctc
actgaaaccatagatgcaataagatctgctcagcggaataattataatgttataatttca
cacaggtctggtgaaacggaggatgttacaatcgcgcatatagcggttgcagcaaattgc
gggcagattaagtcaggctcgttttccaggtcagagcgcctggcaaagtataacgagctc
ctgcgtatagaagaagacctgggtaagagtgctcttctttataatgtgatatag

DBGET integrated database retrieval system