KEGG   Anaplasma marginale Florida: AMF_620Help
Entry
AMF_620           CDS       T00855                                 

Gene name
hemD
Definition
(GenBank) HemD
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
amf  Anaplasma marginale Florida
Pathway
amf00860  Porphyrin and chlorophyll metabolism
amf01100  Metabolic pathways
amf01110  Biosynthesis of secondary metabolites
amf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AMF_620 (hemD)
Enzymes [BR:amf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AMF_620 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 HypD
Motif
Other DBs
NCBI-ProteinID: ACM49462
UniProt: B9KJ00
Position
complement(770364..771077)
Genome map
AA seq 237 aa AA seqDB search
MPMGMLVLTRASADSAKSKGALEELGFDVFVEPMFEVVHLRTEALKLQSYDVTVVTSRNG
VDVIAKLTDERDICILTVGDSTMKRATALGFTNVVSAGGTVRDVISCLNAYQRGTKVLYA
RGEEVSYDLRGAAEKMGFEVEEAVLYKVVARANLSPQCCDLLMNGEILGVVFYSTRTAKI
FTELSRQYSRLLRNVCAYSMSSGVFRALNVGAWKRILVSRRPTEESLFKLLLGIERS
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
ttgcctatgggcatgctggtgttgacccgtgccagtgcagactcagcaaagtccaaaggg
gctctagaggaattggggttcgacgtttttgttgagcccatgtttgaagttgtgcatctg
cgtactgaggccctaaagttgcagtcatatgacgtcactgttgttacgagcaggaatggt
gttgatgttattgccaagcttaccgatgaacgtgatatctgcatattgactgtgggtgac
agcaccatgaagcgtgcgactgctcttgggtttactaatgtggtatctgcgggtggcacc
gtgcgcgatgtaatatcttgcctgaatgcgtaccaacgcggaaccaaggtgctatacgcg
agaggggaggaagtttcatacgatttgcgcggtgctgcagagaaaatgggttttgaggta
gaagaggctgtgctctacaaggttgtagctagagcgaatctgagcccccagtgctgtgat
ctgctcatgaatggtgagatattgggtgtggttttttactcaactaggacggccaagatt
tttaccgagttatccagacaatacagcaggcttctgcgtaatgtttgtgcgtattctatg
agcagcggggtttttcgcgcactgaatgtgggtgcgtggaagcggatacttgtttctcga
cgccccactgaggagtcattgtttaagttattgttaggcattgaaagatcataa

DBGET integrated database retrieval system