KEGG   Alteromonas macleodii English Channel 673: AMEC673_00535Help
Entry
AMEC673_00535     CDS       T02254                                 

Definition
(GenBank) uroporphyrinogen-III synthetase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
amg00860  Porphyrin and chlorophyll metabolism
amg01100  Metabolic pathways
amg01110  Biosynthesis of secondary metabolites
amg01120  Microbial metabolism in diverse environments
Module
amg_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AMEC673_00535
Enzymes [BR:amg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AMEC673_00535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: AFT72813
Position
complement(122691..123422)
Genome map
AA seq 243 aa AA seqDB search
MLLFTRPLPKLKASASAFEKAGIDTVGVATSNIIDISSERKAAAEFLASNAVNAIVVTSV
YAVDTVIEGLRETANELPLIIAVGDATARKLQAGLQAFSSAQVAIPEAHTSEGILAMHQL
NEANCQHVVIIKGEGGRDAIATGLDEKGILVNSFCVYKREQLTSPIYTKRWKMGEVSGII
ATSEAMALQLIAQFGQALKSIKWLTVSDRIAKTLTSQGINEVAVCQRATDQALIAWVKDN
WEY
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgtttacacgcccactgccaaagttaaaagcaagcgcttctgcctttgaaaaa
gccggaattgacacggtaggcgttgccacgtctaacatcattgatatttcgtctgaaaga
aaagctgctgcagaatttttagcgtcaaatgcagtaaacgcaattgttgttaccagcgta
tatgctgtagacaccgttattgaaggcttacgcgaaacggctaacgaattaccattgatc
atagctgtgggcgatgccactgcacgaaaattacaagcgggacttcaggcgttttcatcg
gcgcaggttgctatccccgaagcccatacatccgaaggtatactggcaatgcaccaactt
aatgaggcaaactgtcagcatgtcgttatcattaagggtgaaggtgggcgcgacgccata
gccactggattagacgaaaaaggtattttagttaatagcttttgcgtttataagagagag
caacttacaagcccaatttacacaaaacggtggaaaatgggcgaagttagcggcattatc
gctacaagcgaagcaatggcactgcaactaattgcgcaatttggccaagcacttaaatct
attaaatggttaacagtgagcgaccgaattgccaaaaccctcactagccaaggcattaat
gaggtagcggtttgtcagcgagccaccgatcaggcactcatcgcctgggtaaaggataac
tgggagtattga

DBGET integrated database retrieval system