KEGG   Alteromonas macleodii English Channel 673: AMEC673_04590Help
Entry
AMEC673_04590     CDS       T02254                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
amg00900  Terpenoid backbone biosynthesis
amg01100  Metabolic pathways
amg01110  Biosynthesis of secondary metabolites
amg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AMEC673_04590
Enzymes [BR:amg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     AMEC673_04590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Polysacc_synt_2 NAD_binding_3 Epimerase NmrA GFO_IDH_MocA Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AFT73615
Position
1061987..1063174
Genome map
AA seq 395 aa AA seqDB search
MQTVTVLGATGSIGCNTLDVINRHPDKYRVFAITGNSQLELLMEQAQKCAPRYVVIADDA
NYKLACELASQYGVDAEILAGAKALEEVSSAPEVDAVMAAIVGAAGLLPTLAAVKAGKRV
LLANKEALVMSGALFIEAANQSGAEILPIDSEHNAIFQCLPHDYEYGNFAASGIRKILLT
GSGGPFRERPLDSFSSITIDEASTHPNWSMGRKITIDSATMMNKGLEFIEACWLFGAGAD
DIDVVIHPQSIIHSMVQYVDGSVIAQMGNPDMRTPIAYGLAHPERIEAGVTPLDFSDIGN
FSFQTPCFERYPNLKLAIDACKEGQCATTRVNASNEVAVEAFLEGKIQFCDIAKVNDATL
NAMPNVSVNSIQQILEQDSLARAKANEIIRGKFQC
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacagtaacagtgttaggggccacaggctccattggttgtaatacactcgacgta
ataaatcgccacccagacaaatatcgcgtatttgctattactggcaactcacagcttgaa
ttgcttatggagcaggctcagaaatgcgcgccgcgctatgtggtaattgctgatgacgct
aactacaaacttgcctgtgagttagcatcccagtacggtgtggatgcagaaattctcgct
ggtgctaaggcgctggaagaagtatccagcgcgccagaagttgatgctgtaatggcagcc
attgtgggtgcagcagggcttttacccacactggcagcagtaaaggcgggtaaacgggtt
ttgcttgccaataaagaagcgttagtcatgtctggtgctttatttatcgaggctgcgaac
caaagcggcgctgaaattcttcctatcgacagcgaacacaacgccatattccagtgccta
ccgcacgattatgaatacggtaactttgctgcatccggcattcgtaaaattctcttaacg
ggttctggtggtccgtttagagaaagaccgcttgatagcttctcgtcaattacaatcgat
gaagccagtacacaccctaactggtcgatgggcagaaaaattacaatcgactctgcaact
atgatgaacaaggggctggagttcattgaagcctgttggttgttcggtgctggtgcagat
gatattgatgtggttattcacccgcaaagtattattcattctatggtgcaatatgttgat
ggctcggtgatcgcacaaatgggcaatcctgacatgcgtacccctattgcttatggtttg
gcgcaccctgagcgaattgaagcgggcgtgacgccgctcgacttttctgacattggcaat
ttcagttttcaaaccccttgctttgaacgttatccgaatttgaagctggctattgatgcg
tgtaaagaagggcaatgtgcaacaacgcgagtgaatgcgtctaatgaagtggctgtcgaa
gcctttttagaaggcaagattcagttttgtgatattgctaaagtaaatgacgccacgctt
aatgctatgcccaatgtgtcggtgaattctattcagcaaatactagagcaagacagcctt
gcaagagcaaaagctaacgagattattcgaggtaaattccagtgctag

DBGET integrated database retrieval system