KEGG   Alteromonas macleodii English Channel 673: AMEC673_08090Help
Entry
AMEC673_08090     CDS       T02254                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
amg00071  Fatty acid degradation
amg00072  Synthesis and degradation of ketone bodies
amg00280  Valine, leucine and isoleucine degradation
amg00310  Lysine degradation
amg00362  Benzoate degradation
amg00380  Tryptophan metabolism
amg00620  Pyruvate metabolism
amg00630  Glyoxylate and dicarboxylate metabolism
amg00640  Propanoate metabolism
amg00650  Butanoate metabolism
amg00900  Terpenoid backbone biosynthesis
amg01100  Metabolic pathways
amg01110  Biosynthesis of secondary metabolites
amg01120  Microbial metabolism in diverse environments
amg01130  Biosynthesis of antibiotics
amg01200  Carbon metabolism
amg01212  Fatty acid metabolism
amg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMEC673_08090
   00630 Glyoxylate and dicarboxylate metabolism
    AMEC673_08090
   00640 Propanoate metabolism
    AMEC673_08090
   00650 Butanoate metabolism
    AMEC673_08090
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AMEC673_08090
   00072 Synthesis and degradation of ketone bodies
    AMEC673_08090
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMEC673_08090
   00310 Lysine degradation
    AMEC673_08090
   00380 Tryptophan metabolism
    AMEC673_08090
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AMEC673_08090
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMEC673_08090
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AMEC673_08090
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amg04147]
    AMEC673_08090
Enzymes [BR:amg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AMEC673_08090
Exosome [BR:amg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMEC673_08090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ChlamPMP_M CHGN
Motif
Other DBs
NCBI-ProteinID: AFT74312
Position
1913897..1915078
Genome map
AA seq 393 aa AA seqDB search
MRDAVIVSTARTPIGRAYKGALNNLPAPSLGGHAIQNAVARAGIDPASVDDVVMGAALTQ
GSGGMNIGRLAGLAGGLPVTVAGMTLDRQCSSGMYAIATAANSIRTGDTNIMVAGGLDSI
SLVQNKNMNMFRAVDPALVAKHKDIYMPMLQTAEVVGKRYNISRDVQDEYGYQSQMRTAA
AQEAGKFDDEIVPITATQALFNKETGETSEREVTLSKDEGNRPETTLEGLKALNPVIEGG
CITAGNASQLSDGASATVIMDEHSAAKGNAQPLGIYRGIAVAGCEPDEMGIGPVFAIPKL
LKQHGLTMDDIGLWELNEAFAVQVLYCRDKLGIPDELLNVNGGAISIGHPYGMSGARMVG
HALIEGKRRGAKYVVCTMCIGGGMGAAGLFEVI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatgcagttatcgtaagtacagcacgtacgccaatcgggcgcgcttataaaggt
gcactgaacaatttaccagccccttcattaggtggccatgctattcaaaacgcagtagca
cgcgcagggatcgaccctgccagtgtcgacgacgtggtaatgggcgcagcgctaacccaa
ggcagtggcggcatgaatattggccgcttggctggtttagcgggtggtttaccggtcacc
gtagcgggtatgacactcgaccgccaatgcagttctggcatgtatgccattgctaccgca
gcgaattcaattcgtacgggcgataccaacattatggttgcgggcggcttagattctatc
tctttagtgcaaaacaaaaatatgaatatgtttcgtgcagtagaccctgcactggttgct
aagcacaaagatatttatatgccaatgcttcaaactgcggaagtggtgggtaagcgctac
aacattagccgtgacgtacaagacgaatacggttaccaaagccaaatgcgcacagcagcg
gctcaagaagcaggtaagtttgatgatgagattgtacctatcacagcaacgcaagcctta
tttaataaagaaacaggtgaaacctctgagcgtgaagtgaccttgtcgaaagacgaagga
aatcgcccagaaacaacgcttgaggggcttaaagcgcttaacccagtgatagaaggtggt
tgtattaccgcaggtaatgcaagccagctttctgatggagccagcgcgacagtgattatg
gatgagcactcagcggcaaaaggcaatgctcaacctcttggtatttatcgcggtattgca
gtagcaggctgtgagccagatgaaatgggaattggcccagtgttcgccattcctaagcta
ttaaagcagcatggattaaccatggacgatatcggtctatgggagcttaatgaagcgttt
gcagtacaggtactgtattgccgcgataagttaggcattccagacgaattattaaacgta
aacggcggtgccatttctattggtcacccatacggcatgagcggtgctcgcatggtgggt
catgcactcatcgaaggtaaacgacgcggtgcgaaatatgttgtttgcaccatgtgtatc
ggtggcggcatgggcgctgctggtctatttgaagtaatatag

DBGET integrated database retrieval system