KEGG   Alteromonas macleodii English Channel 673: AMEC673_08770Help
Entry
AMEC673_08770     CDS       T02254                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
amg00010  Glycolysis / Gluconeogenesis
amg00051  Fructose and mannose metabolism
amg00562  Inositol phosphate metabolism
amg01100  Metabolic pathways
amg01110  Biosynthesis of secondary metabolites
amg01120  Microbial metabolism in diverse environments
amg01130  Biosynthesis of antibiotics
amg01200  Carbon metabolism
amg01230  Biosynthesis of amino acids
Module
amg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
amg_M00002  Glycolysis, core module involving three-carbon compounds
amg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMEC673_08770
   00051 Fructose and mannose metabolism
    AMEC673_08770
   00562 Inositol phosphate metabolism
    AMEC673_08770
Enzymes [BR:amg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AMEC673_08770
Exosome [BR:amg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AMEC673_08770
  Exosomal proteins of bladder cancer cells
   AMEC673_08770
  Exosomal proteins of melanoma cells
   AMEC673_08770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFT74448
Position
2080676..2081419
Genome map
AA seq 247 aa AA seqDB search
MSKNLRKPFVAGNWKMNGNLALVAEFNQKLANVKADSEIVICAPSLLLHAFETHSFAIGA
QNVSHLNNGAHTGELSVEMLKEAGCGYAIVGHSERREDQGESSELVALKAKQCVSSGVVP
IICVGEPLEVREAGDVESFVGEQLDALVSAMSVDEISKTVIAYEPIWAIGTGKTASPEQA
QEVHEFIRGYFNNVDAQLAQGLRILYGGSVKPDNAETLFAQKDVDGGLIGGASLKAEDFI
SICQAAN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaaaatcttagaaagccattcgtggctggcaactggaaaatgaacggaaatttg
gcattagttgctgaatttaatcaaaaactggcgaatgtaaaagctgattcggaaatcgta
atttgcgctccttcacttcttttacacgcatttgaaacccattcgtttgccattggtgct
caaaacgtaagtcatcttaataacggcgctcacactggtgagttgtcagttgaaatgctt
aaagaagcaggttgcggttacgcaattgttgggcattcagaaagacgagaagaccaaggc
gagtcaagcgaacttgttgcattaaaggcaaagcaatgtgtttcttcaggtgtcgtaccc
atcatttgtgtaggtgagccacttgaagtgagagaagcaggtgatgttgaatcgtttgtt
ggcgagcaactagatgcactagttagcgccatgtcggtagacgaaatcagcaaaaccgtt
attgcatacgagccgatttgggcaattggtactggtaaaacagccagccctgagcaagca
caagaagtacacgaatttattcgcggctactttaataacgtagacgcacaattggctcaa
ggccttcgtattttgtacggtggtagtgttaagccagataatgctgaaaccctatttgca
cagaaagatgtagatggcggtttaattggcggagccagtttaaaagctgaagattttatt
tcaatttgccaagcggcaaactga

DBGET integrated database retrieval system