KEGG   Alteromonas macleodii English Channel 673: AMEC673_11290Help
Entry
AMEC673_11290     CDS       T02254                                 

Definition
(GenBank) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
amg03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:amg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AMEC673_11290
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:amg03400]
    AMEC673_11290
Enzymes [BR:amg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     AMEC673_11290
DNA repair and recombination proteins [BR:amg03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AMEC673_11290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_19 AAA_30 UvrD_C_2 Viral_helicase1 AAA_11 Helicase_RecD DUF2075 UvrD_C AAA_22 SH3_13 PhoH UvrD-helicase ResIII Flavi_DEAD IstB_IS21 TrwB_AAD_bind PaREP1
Motif
Other DBs
NCBI-ProteinID: AFT74948
Position
complement(2632428..2634635)
Genome map
AA seq 735 aa AA seqDB search
MKSNQHSVPSFFDNLFGIEAIDKFVAKEFGFIDELEQEEQFIWAGILAYLSYMQRNGHSC
IYLKDIAGTTLFKEVVAEQEAVLAAETNVHSNNGAVGASKSPVEQTEQEKAPKAGVDVPQ
LTPLLRIVKSALVNEQVAQLFVYSNGKLYSRRYYEFEQEVARNVVKRAALTPLSDDASEK
VKQLWPAIFPTETTDQQDWQQIAVAKSLMQRFCVINGGPGTGKTYTVLRLLLALQACDEN
LKIVLAAPTGKAQQRMTESIMNSIDGLRGKLDDTVLNNVPTDAVTLHRLLGLREHGVSTK
FNQHNQLAADVLIVDEASMVDLALMTRIVRALPDHARLYFIGDADQLPAVELGNVLEQLV
STEAASFDENANVPNGTNSLNSNDNAFSLDGVPSLMRQHIATLCPHLPLLPVDEQAKSYV
ATLQAPQRFKGQVAKVATAIQRGDASGALAAITDKASDNDETAGLNSNIDSTLVSKTASR
LQSGVHLWPEHQVSGRDLHQLAKESFLPIFDAGSAEEALNRLNVVRWLTPVRKGGMGVEG
LNNLVFDAIKHKIRKREGHFYQGQPIMIVKNHHPQRLSNGEVGVIWPDSKGKLYAWFYQD
SQASGQNGSNQKASANAGDSADNTLEQKQALRSISLSRVPQFETVYAMTIHKSQGSEFNH
VVLILPKPDSEKAANLFHRGLVYTGLTRAKDGCLIISDNATFTHMVQRVDKRYSGLSEAI
SLHLESTSNATTEIE
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcaatcaacactctgtaccgtcattttttgataacttgtttggcatcgaggcg
atcgacaaatttgtcgcaaaagaatttggctttattgatgaactggagcaagaagaacag
tttatttgggctgggatcttagcatacttgtcgtatatgcagcgcaatggccacagctgt
atctatctaaaagacatagcgggtacgacgctttttaaagaggtagtagcagaacaagaa
gcagtcttggcggccgaaacaaatgtgcatagcaataacggagcggttggggcatctaag
tcgccggtagaacaaacagagcaggaaaaagcgcccaaagcaggtgttgacgtgccacaa
ctaacgccgttacttagaattgtaaaaagcgcactggttaacgagcaggtggctcaacta
tttgtctatagcaacggcaagctgtacagccgtcgctactatgagtttgaacaagaagtg
gcgcgcaatgttgtaaaacgagctgcgcttacgccgttaagtgatgacgcaagcgaaaaa
gtaaaacaactttggcccgcaatctttcctaccgaaacaaccgatcagcaagattggcag
caaattgcagtggccaaaagcctaatgcagcgcttttgcgttataaacggtgggccagga
acaggtaagacctatactgtattgcgcttattactggcgctacaggcttgcgatgaaaac
ttaaaaattgtgctggcagcgcctacaggtaaagcgcaacagcgtatgaccgaatctatc
atgaacagcatagacgggcttcgcggcaagttggacgacacagtgcttaacaacgtgcct
accgatgctgtgacgctacatagattactaggattgcgcgagcacggtgtatcgactaag
ttcaatcagcacaatcaattggcagcagatgtactcattgtcgatgaagcaagtatggtc
gacttagcgctaatgacgcgcatcgtacgagcgttaccagaccatgcgcgactctatttt
atcggtgatgccgatcagcttccagcagttgagcttggcaacgtgttagagcagctagtt
agtaccgaggcagcaagttttgacgaaaatgcgaatgtgccaaatggtacaaatagctta
aacagcaatgacaacgcgttttctttagatggcgtgccatcgttaatgcgtcagcacatc
gctacgctgtgcccgcatttgcctctgttacctgttgatgagcaggcaaaaagctatgta
gcaactctgcaagcaccgcagcgcttcaaagggcaggtggcaaaagttgcaacggccata
cagcgaggtgatgcaagcggtgcacttgccgctattaccgacaaggctagtgacaatgat
gaaactgctggcctcaactcaaatatcgattcaactcttgtttcaaagactgcatcacgc
ctacaatctggcgttcacctatggccagagcaccaggttagcggccgtgatttacaccag
ttggccaaagaaagcttcctgcctatttttgatgctggcagtgccgaagaggcgcttaat
cgtctgaatgtggttaggtggctaaccccggtccgcaagggcggaatgggcgtagaaggc
ctgaataatttggtgttcgatgctatcaagcacaaaatcagaaagcgggaaggccatttc
tatcaaggtcagcccattatgattgtaaagaatcatcatcctcaacgactatcaaacggt
gaggttggtgtaatctggcctgacagcaaaggaaagctatatgcgtggttttaccaggat
agccaagcttcgggtcaaaacggttcaaatcagaaagcttcggcaaatgcgggagacagt
gctgacaatacgctagagcaaaagcaagcgttgcgcagcatatcgctatcaagagtaccg
cagtttgaaactgtgtacgccatgaccatacataaatctcagggctctgagtttaatcat
gttgtgcttattttacctaagcctgatagcgaaaaagccgccaacttatttcatcgaggc
ctagtgtacacagggttaacccgtgccaaagacggctgcttaatcatttctgacaacgca
acatttacccacatggttcaacgggtagataagcgttattccgggctgtctgaagcgatt
agcctgcacctagagagcacatcaaacgccaccacagaaattgaataa

DBGET integrated database retrieval system