KEGG   Alteromonas macleodii English Channel 673: AMEC673_12735Help
Entry
AMEC673_12735     CDS       T02254                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
amg00740  Riboflavin metabolism
amg00790  Folate biosynthesis
amg01100  Metabolic pathways
amg01110  Biosynthesis of secondary metabolites
Module
amg_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:amg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    AMEC673_12735
   00790 Folate biosynthesis
    AMEC673_12735
Enzymes [BR:amg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     AMEC673_12735
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     AMEC673_12735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AFT75233
Position
complement(2975105..2976205)
Genome map
AA seq 366 aa AA seqDB search
MAFNTTQEIIEDIRQGKMVILMDDEDRENEGDLIMAAEHVTPEAINFMVTHARGLVCLPM
TQERCRALNLPLMVDKNEAQFSTNFTVSIEAATGVTTGISAADRATTIKAAVAKDAKATD
IVQPGHIFPLIAKDGGVLNRAGHTEAGVDLPRLAGLEPAGVIVEILNEDGTMARRPELEK
FAEKHNLKIGTIADLIEYRNLNETTIQKVAQCNMPTEYGDFELHTFKDSIDNQLHFALKK
GEIKEDEPTLVRVHLHNTFSDLLGSTRGIHRSMTLADGMRKISEDGGVLVLLGKEEHIES
QVRRFAAEDRGERPTGADWQGSSRTIGVGSQILASMGVHKMRLLSKPIKYHALSGYGLEV
VEYVHD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcatttaacactacacaagaaataattgaagacattcgccaaggtaaaatggttatc
ttgatggatgacgaagacagggaaaatgaaggcgatttgataatggcggcagagcatgtg
acgcctgaagccattaactttatggtaacccacgctcgtggtttagtgtgtttaccaatg
acgcaagagcgctgtcgcgccctgaatcttccgcttatggtggataaaaacgaagcacag
ttttctaccaacttcactgtgtctattgaagcggcaaccggcgtgaccacaggcatttcg
gcggcggatcgcgcaacgaccattaaagctgctgtagcgaaagatgcgaaagcgacagac
attgtacagccgggtcatatttttccgctaattgctaaagacggtggcgtgttaaaccgc
gcaggtcacactgaagctggtgtagatttaccgcgtttggcagggttagagcctgctggg
gttattgtagaaatcctcaatgaagacggcacgatggcccgtcgtccagaactagaaaag
tttgctgaaaaacataatcttaaaatcggcaccattgctgatttaattgaatatcgcaat
ctcaacgaaaccaccattcaaaaggtcgctcaatgcaatatgccaaccgagtatggtgac
ttcgagcttcacacgtttaaagacagtatcgacaaccaacttcatttcgcacttaaaaaa
ggcgaaattaaagaagatgagccgacacttgtacgtgtacaccttcacaatacctttagt
gatcttcttgggtctacccgcggtattcatcgctcgatgacgcttgcagatggcatgcgc
aaaatttcagaagacggtggcgtattggtgctattaggtaaagaagagcatattgaaagt
caggtacgccgctttgccgcagaagaccgaggcgagcgcccgactggcgctgactggcag
ggatcgtcacgcactattggtgtaggcagtcaaattctagcatcaatgggcgtacacaaa
atgcgccttcttagtaaaccaattaaatatcacgcactttcaggttacggccttgaagta
gtggagtacgtgcacgactag

DBGET integrated database retrieval system