KEGG   Alteromonas macleodii English Channel 673: AMEC673_13340Help
Entry
AMEC673_13340     CDS       T02254                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
amg00220  Arginine biosynthesis
amg00250  Alanine, aspartate and glutamate metabolism
amg00471  D-Glutamine and D-glutamate metabolism
amg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMEC673_13340
   00220 Arginine biosynthesis
    AMEC673_13340
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AMEC673_13340
Enzymes [BR:amg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     AMEC673_13340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase TT_ORF2a
Motif
Other DBs
NCBI-ProteinID: AFT75354
Position
complement(3108230..3109138)
Genome map
AA seq 302 aa AA seqDB search
MLALLQDIYDEVEPMLGMGKVADYIPALATVNPRQFGISICDTNGQITSIGDASVPFSIQ
SISKVFNLVLAINHYGETMWERVGCEPSGLPFNSLVQLEYENGIPRNPFINAGALVVSDM
VQSRFASPYIAMRDFVRRLSCNGDIVVNKVVAESEYEHRSRNAAMAYLMKAYGNFENEVE
DVLRNYFHNCALEMSCEDLARSTSFLANAGFSTCANEKVLTPYQTKQVNALLATSGMYDE
AGSFAFKVGLPGKSGVGGGIVAVVPGRFSICVFSPALNSVGNSQLGVAALTSLSERINWS
IY
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgctggcactacttcaagatatctatgatgaagttgagcccatgttgggcatgggaaaa
gttgccgactacatccctgcgttggccacggttaatccacggcaatttggcatttcaatt
tgcgatacaaacggtcaaataacgtcgataggcgatgcgagcgttcctttttctattcaa
agtatctcaaaagtctttaatcttgttttagctatcaatcactacggtgaaaccatgtgg
gagcgagttggatgcgagccatccggcctgccgtttaattctcttgtacagttggaatat
gaaaacggtattccccgcaaccccttcattaatgccggtgcgctggtggttagtgacatg
gtgcaatctcggtttgcttccccttatattgccatgcgagatttcgtaagacgtttaagt
tgtaacggcgacatcgtggtaaataaggtggtggcggagtctgaatacgagcaccgctct
cgcaatgcagcaatggcatatttgatgaaagcctacggaaattttgaaaacgaagtggaa
gatgtgcttcgtaattattttcacaactgtgcactagaaatgagttgtgaggacttggca
cgctcaacgagctttcttgctaacgcaggtttttctacttgcgcaaatgaaaaggtgcta
acaccttatcaaaccaaacaagtgaacgcgcttctggcgactagcggtatgtatgacgaa
gctgggagctttgcttttaaagtaggcttgccgggtaaaagtggcgtaggtggaggcata
gtggctgttgtaccaggacgcttttcaatatgcgtattttcgccagcgcttaatagcgtg
ggtaattctcagctaggtgtggcggctttgacatcgctaagtgaacgcatcaattggtct
atttattag

DBGET integrated database retrieval system