KEGG   Alteromonas macleodii English Channel 673: AMEC673_14175Help
Entry
AMEC673_14175     CDS       T02254                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
amg00520  Amino sugar and nucleotide sugar metabolism
amg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AMEC673_14175
Enzymes [BR:amg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     AMEC673_14175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 Aldo_ket_red
Motif
Other DBs
NCBI-ProteinID: AFT75517
Position
complement(3314934..3316085)
Genome map
AA seq 383 aa AA seqDB search
MKTIILAEKVLMNGAWQHNQVLSIEKGVIADIAPLSYFKKDATATINERIRGAVIPGYID
TQVNGGGGAMFNHAPTFESINVMAEAHLKYGTTTLFPTLITDDIDTIEQAADAVSEAIAQ
AHPSVEGVHFEGPHLSVEKKGVHLPRYIRALSDRELATYTRRDIGQVLITVAPENVPCDI
IRDLVGQGVIVALGHSNAPFETVQNALDAGASGFTHLYNAMSPLTSREPGMVGAALLNNS
VCGIIVDHHHIHPKAVEFAYKVKGPHQLMLVTDAMAHVGASDDTIAFFDTHITRQDNKLT
TPDGTLAGSCLDMHGAVTNSINDINIALEHASTMASATPARFTKIHDRVGELEVGKRANF
LVINNDNTLLEVWQNGRKRLCAN
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccattattctggctgaaaaggtgctgatgaacggtgcctggcagcataatcag
gtgctgagcattgaaaagggtgtgatagctgacattgcacctctttcttactttaagaaa
gacgcaacggcaacaatcaacgagcgcatacgtggtgcagttattccaggctacatcgac
acgcaggtaaatggtggtggaggcgcgatgtttaatcatgctcccacgtttgaaagcata
aacgtgatggccgaagcacatctgaaatacggcaccaccacattgttcccaacgctcatt
accgacgatatagacaccattgagcaagcggcagatgcagtaagcgaggccattgcacag
gcgcaccccagcgttgagggggttcattttgaagggccgcacctttctgttgagaaaaaa
ggcgtgcacttgccgcgctatattcgcgcactttcagatcgtgaactggcaacctatacc
cgaagagatattggacaagtccttatcaccgttgcgcctgaaaacgtgccttgcgacatc
atccgagatttggtggggcaaggagttattgttgcattagggcactcaaacgcaccgttt
gaaaccgtgcaaaatgcattagacgctggggcatcaggctttacccacctttataacgcc
atgtcgccactgacttctagagagcctggaatggttggggcggcgctacttaacaacagc
gtgtgcgggataattgtggaccatcatcacattcacccgaaagccgtagagtttgcttat
aaggtgaaagggccgcatcaattaatgctagtgactgacgccatggcccacgtgggcgca
agcgacgacaccatcgcgttcttcgatactcatatcacgcgccaagataataagttaacc
acgcccgacggcacgttagccggtagctgtttagatatgcacggcgcagtaacgaacagc
attaacgacatcaatatcgcattagaacatgccagtaccatggcaagcgcaacgccagca
cgcttcaccaaaatacatgatagggtaggtgaactagaggtaggaaagcgcgctaacttt
ttagtgataaacaacgacaatactctgttagaagtgtggcagaacggacgtaaacgcctt
tgcgctaactaa

DBGET integrated database retrieval system