KEGG   Alteromonas macleodii English Channel 673: AMEC673_16090Help
Entry
AMEC673_16090     CDS       T02254                                 

Definition
(GenBank) putative delta-9 fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
amg01040  Biosynthesis of unsaturated fatty acids
amg01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AMEC673_16090
Enzymes [BR:amg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     AMEC673_16090
Lipid biosynthesis proteins [BR:amg01004]
 Desaturase
  First
   AMEC673_16090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase GNAT_acetyltran
Motif
Other DBs
NCBI-ProteinID: AFT75900
Position
3771708..3772835
Genome map
AA seq 375 aa AA seqDB search
MKKPPLILTNVLVFIISGAIAFIGVPLWVAYQGIDWAEIGAAIFLFYFTGMSITAGYHRL
WSHKTYDANVVVRVILAIGGAMALQNSILHWSSDHRVHHRHVDDNDKDPYSAKKGLWFAH
IGWMLREYQAKRYDDYSNCKDLQKDKVVMWQHNYYLPIVLAANFGITGLLGYLNGDVLGM
ILVAGVLRLVLVHHVTFFINSLAHFWGSQPYTDKNTARDNGILAFFTFGEGYHNYHHIFE
YDYRNGIRWYQFDPTKWLIKGLSLVGLTSNLRKVPEERIEKALAAMQLQRASEKVSLLPN
AEEMMHTIQEEYDLLMQRMSEYYATKKRVMRVKQRTLKRSIEGLELAYKYKELKHAFAVQ
KEKWTQLHSLSLQMA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacctcctcttatccttactaatgtgctggtatttattatatctggcgccatt
gcgtttattggtgtgccgctatgggtggcgtatcaaggcatcgattgggcagaaatcggt
gcggctatattcctattttactttaccggtatgtctataactgccggctatcaccgctta
tggtcgcataaaacttacgacgccaatgtggtagttcgtgtgatccttgcgattggtggc
gctatggcgctgcaaaatagtattttgcactggtcgtcagatcatcgcgttcatcatcgt
catgttgatgataacgacaaagacccctactctgcgaagaaggggctttggtttgcgcat
atcggctggatgttgcgtgagtatcaggccaaacgttacgatgactacagtaactgtaaa
gatcttcaaaaagataaagtggtgatgtggcagcataactactatttgcccatcgtgctg
gcggccaactttggtatcacaggtcttctgggctatttaaatggtgacgtattaggcatg
atcttggtagccggtgtacttcgcctggtgctagtgcatcacgtaaccttctttatcaat
tcgcttgctcatttttggggtagccagccttacaccgataaaaacacagcacgagataac
ggtattcttgcgttttttacctttggtgaaggttatcacaattaccatcacatctttgag
tacgactatcgtaatggcattcgctggtatcagtttgatcctacaaaatggcttattaag
gggttatcactggtaggactgacatccaaccttcgcaaagtgccagaagagcgcatcgag
aaagcgttagcagcaatgcagctgcaaagagcaagtgaaaaagtatcgctactgcctaat
gctgaagaaatgatgcataccattcaagaagaatacgacttgttaatgcagcgcatgagt
gaatactacgccacgaaaaaacgtgttatgcgcgttaaacaacgcaccctaaagcgcagt
atcgaagggcttgagcttgcatacaagtacaaagagctgaaacacgcatttgctgtacag
aaagagaaatggacacagttacatagtttgtcattgcaaatggcgtaa

DBGET integrated database retrieval system