KEGG   Alteromonas mediterranea 615: I633_01805Help
Entry
I633_01805        CDS       T02719                                 

Definition
(GenBank) cryptic haloacid dehalogenase 1
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
amh  Alteromonas mediterranea 615
Pathway
amh00361  Chlorocyclohexane and chlorobenzene degradation
amh00625  Chloroalkane and chloroalkene degradation
amh01100  Metabolic pathways
amh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    I633_01805
   00361 Chlorocyclohexane and chlorobenzene degradation
    I633_01805
Enzymes [BR:amh01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     I633_01805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Put_Phosphatase COG2
Motif
Other DBs
NCBI-ProteinID: AGP76695
UniProt: S5AAP8
Position
complement(343268..343939)
Genome map
AA seq 223 aa AA seqDB search
MTPRVIFFDINETLLDMQAIKTGLATVLEGDETLVDLWFANLLHHSLVDAMSSQFHDFID
VGGAALTMVAHSKNIALDEKTAKDTIKQYITKLPAHDDVIPTLKALHSAGIALVALSNSS
ETGLNAQLEYANIKHYFSHVLSVERVRTYKPHPAVYHWACQQAHVKNEEAMMVAAHGWDV
SGAKATGMRTTFVERPGKMMYPLGLTPDHSIASLNELVSLVTR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccacgggtaatattcttcgatatcaacgaaacactattggatatgcaggccatt
aaaacggggctcgcaacggttttagagggtgatgaaacgctggtagacctgtggtttgct
aacttgcttcaccatagtttagtcgacgccatgtcttcacagtttcacgacttcattgat
gtgggcggggcagcacttacgatggtggcccacagtaaaaacattgcgctagatgaaaaa
acggcaaaagacaccattaagcaatacattacgaagctgcctgcgcatgatgatgtcatc
cctacgctcaaagctctccacagtgccggtattgctttggtagcgctatctaattcatct
gaaactggcttaaatgctcaactagaatatgccaatattaaacactacttttcccacgtg
ttgagtgtagagcgcgtacgaacctacaagcctcaccccgcggtgtatcactgggcttgc
caacaagcccatgtgaaaaatgaagaggcaatgatggttgccgcgcacggatgggacgta
agcggggctaaagcaacgggaatgcgaactacgtttgtagaacggccagggaaaatgatg
tacccgctcggtttaactcccgatcacagtattgcatcattgaatgagctggttagttta
gtaactcgttaa

DBGET integrated database retrieval system