KEGG   Alteromonas mediterranea 615: I633_02690Help
Entry
I633_02690        CDS       T02719                                 

Definition
(GenBank) gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
amh  Alteromonas mediterranea 615
Pathway
amh00430  Taurine and hypotaurine metabolism
amh00460  Cyanoamino acid metabolism
amh00480  Glutathione metabolism
amh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    I633_02690
   00460 Cyanoamino acid metabolism
    I633_02690
   00480 Glutathione metabolism
    I633_02690
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:amh01002]
    I633_02690
Enzymes [BR:amh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     I633_02690
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     I633_02690
Peptidases and inhibitors [BR:amh01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   I633_02690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept Ntox33
Motif
Other DBs
NCBI-ProteinID: AGP76846
UniProt: S5ADJ9
Position
complement(536429..538126)
Genome map
AA seq 565 aa AA seqDB search
MIKRIMILAVISVMVACSNAPNTTIDNANNTDVGLSQPAVAMPDSYSADAAMQVLKEGGN
AIDAAITAQFVLAVTLPEAGNVGGGGFMTIKFEDSTDFLDYREMAPKSAHRDMYLDQAGN
VKPYESLFGAKASGIPGTVAGMWAAHKKYGTLDWERLVAPAVDLAENGFVVHEKLANNIA
RYISRTQEKGIKSNFSDYFSEAKAGTTFKQPELAETLKAIQQQGKDGFYKGEVATHIVDF
MQQNGGLITHDDLQAYKAVWRKPLQLTWQGYELITAPPPSSGGVAVAQWIGMLEAYDATH
DLPAQNSTEYIHVMSEIGKRVFADRAEYMGDPDFVSVPVKALTDANYINERAADIQPASI
SDTPSIKPGLKESEDTTHFSIMDRWGNAVANTTTINLTFGSGVVVTGAGFLLNDEMDDFS
AKPGVPNFFGAVGGEANAIEPYKRMLSSMTPTLVTKADQVVLVTGSPGGTTIISSVAQSL
LNALLYDMSAEEAVNSPRFHHQLLPKDTIRMHNGFTEATVNELKAMGYTIDNRRFGDVHL
IKRTKEGVEAASEKSGRGKSIVQPY
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacggataatgattttagcggttatttcggtgatggtggcgtgctcaaacgct
cctaacaccactattgataacgccaacaataccgacgtaggtcttagccaacctgcggtg
gccatgccagacagctatagtgccgacgccgctatgcaggtgcttaaagagggcggaaat
gcaatagatgccgctattacggcgcaatttgttttagccgtgaccctgccagaagccggt
aacgttggcggcggtggctttatgaccatcaagtttgaagacagcaccgactttctcgac
tatcgtgaaatggccccgaaaagcgcccatcgcgatatgtatttagaccaagcaggtaac
gtaaagccttatgaatccttatttggcgcgaaagcatcaggtattcccggtactgttgcg
ggtatgtgggcagcacataagaagtacggcactttagactgggagcgtcttgtggcccct
gcggtagaccttgccgagaacgggtttgtagtacacgaaaagttagccaataacattgcg
cgctatatttcacgtacccaagagaaaggcattaaaagtaacttcagtgattatttctca
gaagccaaagcaggcaccacgtttaagcagcctgaactagctgaaaccctaaaagcgatt
caacagcagggtaaagatgggttctacaaaggcgaagtcgccacgcatattgtcgatttt
atgcaacaaaatggcggccttattacccatgatgacttgcaagcctacaaagcagtgtgg
cgtaagccccttcagctgacttggcagggttatgaattaattactgcaccgccgccaagt
tcagggggcgtggctgtagcacaatggattggcatgcttgaagcctatgatgcaacccac
gatttacctgcgcaaaacagcactgaatatattcacgttatgtctgaaataggcaagcgt
gtatttgccgatcgcgctgaatacatgggcgaccctgactttgttagtgttccggtaaaa
gcgctcacagacgctaactacattaatgaacgcgcagcagatattcagcctgccagcatt
tctgataccccaagcattaagccgggcttgaaagagagcgaagatactacccacttctcg
attatggacagatggggcaacgccgttgccaataccacaaccatcaaccttacttttggt
agtggtgttgttgtaactggcgccggcttcttgttgaacgatgaaatggatgactttagc
gcaaagcctggtgtgcctaatttcttcggcgccgtgggcggagaagcgaatgccattgaa
ccctacaagcgcatgctttcttctatgacccctacacttgtgaccaaagccgaccaggtc
gtgcttgttacaggctctccaggtggtaccaccattatatcgtcagttgctcaatcgcta
ttgaatgccctgctttacgatatgagcgccgaagaagccgtgaattcaccgcgttttcac
caccagctattaccgaaagataccattcgtatgcacaacgggtttaccgaagctacggtg
aacgagcttaaagccatgggctataccattgataaccgacgctttggtgatgtgcattta
attaaacgcacaaaagagggtgtggaagccgcgtctgagaaaagtggccggggtaaaagc
attgtgcagccctactaa

DBGET integrated database retrieval system