KEGG   Alteromonas mediterranea 615: I633_04260Help
Entry
I633_04260        CDS       T02719                                 

Definition
(GenBank) Phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
amh  Alteromonas mediterranea 615
Brite
KEGG Orthology (KO) [BR:amh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    I633_04260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AGP77100
UniProt: S5ABL8
Position
845093..846340
Genome map
AA seq 415 aa AA seqDB search
MEFFESYGLILIILAAGVGFVMAWGIGANDVANAMGTSVGSKALTIKQAIIIAMIFEFAG
AYLAGGEVTSTIRKGIIDSTFFIDIPEYLVLGMISSLLAAGIWLAVASWLGWPVSTTHSI
IGAIIGFTATGVSMDAVAWGKVGGIVGSWVVTPAISGIIAYLIFMSAHKLIFQTDSPFVY
AKRYVPFYMALAGFVMSLVTIKKGLKHVGLELSAVNGYLLAIAIAVALGFVGKWFIGRMK
FSGSEDADLQAANVEKVFALLMVVTACSMAFAHGSNDVANAIGPLAAVVSVVTSGGEINS
SATLAWWILPLGGLGIVAGLALFGHRVIKTIGQGITHLTPSRGFAAELAAACTVVIASGT
GLPISTTQTLVGAVLGVGLARGVSALNLGIVRNIVVSWIVTLPAGHYFQLFSSSS
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtggaattttttgaaagttatggcctaattcttattatccttgccgccggcgttggtttc
gtcatggcatggggtattggagcaaatgacgttgccaacgcaatgggtacgtcggtaggt
tctaaagctttaactattaaacaagctattatcattgcaatgatatttgagtttgctggc
gcctacctagccggtggcgaagtaacgtctactattcgaaaaggaattatcgactcaacc
ttctttatagacatccctgaataccttgtattgggcatgatatcatcgctactagctgcc
gggatttggcttgctgtggcgtcatggttggggtggcccgtttctactacgcattcaatt
atcggcgctattattggtttcactgccactggcgtgagtatggatgcggtagcgtggggt
aaagtaggcggcattgtaggtagttgggtggtaacgccagccatatcaggcattatcgcg
taccttatctttatgagcgctcacaagctcattttccaaaccgactcaccgtttgtttac
gccaagcgctatgtgccattttacatggcgttagcgggcttcgttatgtcattggttacc
attaagaaaggcttgaagcacgtaggtttagaactgagtgctgttaacggttatcttttg
gcgattgctattgccgtggcattgggcttcgtgggtaaatggtttatcggccgtatgaag
tttagcggctctgaagatgccgatttacaggcggcaaacgtagagaaagtcttcgcgctg
cttatggttgttactgcatgcagtatggccttcgcccatggctcgaacgacgtggctaat
gctattggtcctctcgcggcagtggtaagcgtggtgaccagcggtggtgagattaattca
agtgccactttggcctggtggatcctgccgttaggtggtttaggtatcgtagctggcctg
gctctatttggtcatcgtgttattaaaacgattggtcagggtattactcacttaacgcca
agccgtggctttgctgcagaacttgctgcagcctgtacggtggttattgcatcgggtaca
ggtctgccaatttcaacaacgcaaacattggtgggtgccgtgttaggtgtaggtttagcg
cgaggcgtttcagcactgaacttgggcattgtgagaaatatcgttgtatcctggattgta
actttgccggcagggcactactttcaattattttcttcttcatcttaa

DBGET integrated database retrieval system