KEGG   Alteromonas mediterranea 615: I633_09080Help
Entry
I633_09080        CDS       T02719                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
amh  Alteromonas mediterranea 615
Pathway
amh00071  Fatty acid degradation
amh00072  Synthesis and degradation of ketone bodies
amh00280  Valine, leucine and isoleucine degradation
amh00310  Lysine degradation
amh00362  Benzoate degradation
amh00380  Tryptophan metabolism
amh00620  Pyruvate metabolism
amh00630  Glyoxylate and dicarboxylate metabolism
amh00640  Propanoate metabolism
amh00650  Butanoate metabolism
amh00900  Terpenoid backbone biosynthesis
amh01100  Metabolic pathways
amh01110  Biosynthesis of secondary metabolites
amh01120  Microbial metabolism in diverse environments
amh01130  Biosynthesis of antibiotics
amh01200  Carbon metabolism
amh01212  Fatty acid metabolism
amh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    I633_09080
   00630 Glyoxylate and dicarboxylate metabolism
    I633_09080
   00640 Propanoate metabolism
    I633_09080
   00650 Butanoate metabolism
    I633_09080
  Lipid metabolism
   00071 Fatty acid degradation
    I633_09080
   00072 Synthesis and degradation of ketone bodies
    I633_09080
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I633_09080
   00310 Lysine degradation
    I633_09080
   00380 Tryptophan metabolism
    I633_09080
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    I633_09080
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    I633_09080
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    I633_09080
Enzymes [BR:amh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     I633_09080
Exosome [BR:amh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I633_09080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ChlamPMP_M CHGN
Motif
Other DBs
NCBI-ProteinID: AGP77835
UniProt: S5ADH2
Position
1829590..1830771
Genome map
AA seq 393 aa AA seqDB search
MRDAVIVSTARTPIGRAYKGALNNLPAPSLGGHAIENAVSRAGIDPASVDDVIMGAALTQ
GSGGMNIGRLAGLAGGLPVTVAGMTLDRQCSSGMYAIATAANAIRTGDTNIMVAGGLDSI
SLVQNKNMNMFRAVDPALVAKHKDIYMPMLQTAEVVGKRYNISRDVQDEYGYQSQMRTAA
AQEAGKFDDEIVPITAVQAVFNKETGETSEREVTLSKDEGNRPETTLEGLKALNPVIEGG
CITAGNASQLSDGASATVIMDEQSAAKGSAQPLGIYRGIAVAGCEPDEMGIGPVFAIPKL
LKQHGLTMDDIGLWELNEAFAVQVLYCRDKLGIPDELLNVNGGAISIGHPYGMSGARMVG
HALIEGKRRGAKYVVCTMCIGGGMGAAGLFEVI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatgcagtaattgtaagtacagcacgtacaccaataggccgtgcctataaaggc
gcactaaacaacttacccgcgccgtcgttaggtggtcatgccattgaaaatgcggtatct
cgtgcgggtattgaccctgctagcgtagatgacgtcatcatgggcgcagcgctcacacaa
ggcagcggtggtatgaacatcggccggttagccgggcttgccggcggccttcctgttacg
gttgcgggtatgacccttgaccgtcaatgtagttcaggtatgtacgccatcgctacagca
gcaaatgctattcgtactggcgataccaacattatggtagccggtggtttagattctatt
tcactggtacaaaacaagaacatgaatatgttccgtgccgttgaccctgcacttgttgct
aagcacaaagatatctacatgccgatgcttcaaaccgctgaagtggtaggcaagcgttat
aacattagccgcgatgtacaagatgagtacggctaccaaagtcaaatgcgcacagcagca
gcgcaagaggccggtaagtttgacgacgaaattgtacctattacagcagttcaagcggtg
ttcaataaagaaacgggtgaaacctctgagcgcgaagtcaccttgtctaaagatgaaggt
aatcgcccagaaactactcttgaaggtttgaaagcgttaaaccctgttattgaaggcggc
tgcattacagctggcaacgcgagccagctttcagacggcgcaagtgcaacagttattatg
gatgagcagtcagcagcgaaaggcagtgctcagccacttggtatttatcgcggtattgca
gtggcaggctgtgaacctgatgaaatgggaattggcccggtattcgccattcctaagcta
ttaaagcagcatggattaaccatggacgatatcggtctatgggaacttaacgaagcattt
gcagtacaggtactctactgccgcgacaagttaggtattccagacgaattattaaatgta
aacggcggtgccatttctattggtcacccatacggcatgagcggtgctcgcatggtgggt
cacgcactcatcgaaggtaaacgacgtggtgcgaaatatgtagtttgcaccatgtgtatc
ggtggcggcatgggcgctgctggtctatttgaagttatatag

DBGET integrated database retrieval system