KEGG   Alteromonas mediterranea 615: I633_15475Help
Entry
I633_15475        CDS       T02719                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
amh  Alteromonas mediterranea 615
Pathway
amh00010  Glycolysis / Gluconeogenesis
amh00020  Citrate cycle (TCA cycle)
amh00620  Pyruvate metabolism
amh01100  Metabolic pathways
amh01110  Biosynthesis of secondary metabolites
amh01120  Microbial metabolism in diverse environments
amh01130  Biosynthesis of antibiotics
amh01200  Carbon metabolism
Module
amh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:amh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I633_15475
   00020 Citrate cycle (TCA cycle)
    I633_15475
   00620 Pyruvate metabolism
    I633_15475
Enzymes [BR:amh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     I633_15475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 Peptidase_M23 RTBV_P12
Motif
Other DBs
NCBI-ProteinID: AGP78866
UniProt: S5AIY2
Position
complement(3170718..3172754)
Genome map
AA seq 678 aa AA seqDB search
MSDIQKIIVPDVGGDEVEVIELCVAVGDNIEADEGVVTVESDKASMDIPAPFEGEIVSLS
VSVGDKIKEGDVIGEMKVAGGDSAGEGASEENASDESSKEDAPKQEEAPKAESKSEAAPA
ASGSSEVIEVAVPDIGSDDEVDVIDVLVSVGDTIEKEDGLITLETDKATMDVPSTHAGTV
KEVFISTGDKVKEGTVVIKLEVAGSGSSSSESASSEASSEASAPAAQESEKQESAPAASA
GSETIEVAVPDIGEDGEVDVIDVLVSAGDTVEKEDGLITLETDKATMDVPSTHAGTIKEV
FIKAGDKVKQGTLVVKLETSGGSSSNAAEKPAEAPKQDSQQEESKQASQQEASQGRSPVP
PAPEAKNTGKAHASPSVRRIAREFGVDLTQVNGSGPKNRILKEDVQAYVKAELAKPRTAA
ASGSAPVGDNVLQIVPVKPVDHSKFGEIEEQKLSRIQKISGPFLHRNWATIPHVTQFDEA
DITEVEEFRKEQNAYHAKIKSGLKITPLVFVMKAVAKALEKYEVFNSSLSDDGESLIIKK
FINIGIAVETPGGLVVPVIRDVNKKGIEQLSRELIETSQKAREGKLKAADMQGGTFTISS
LGGIGGTAFTPIVNAPEVAILGVSKSEMKPKWNGKEFEPRLMVPLSLSYDHRVIDGAVGA
RFSTEVAANLTDLRRIIL
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatattcaaaagattatcgtacccgacgtaggcggtgacgaagttgaagttatc
gagctatgtgttgccgtaggcgacaacattgaggctgatgaaggcgttgttactgtagaa
agtgacaaggcgtcaatggacatcccagcaccgtttgaaggtgagattgtaagcttgtct
gtatcagtaggcgataaaatcaaagaaggcgatgtgattggtgaaatgaaagttgcaggt
ggtgacagtgccggtgaaggcgcgtctgaggaaaacgcttcagatgaatcttctaaagaa
gatgcacctaagcaagaagaagcaccaaaagcagaaagtaagtcagaggcagcacctgct
gcgtctggcagcagcgaagtgattgaagttgcagtaccggatatcggttctgacgacgaa
gttgacgtaattgacgtattggtttcagtgggcgacaccatcgaaaaagaagatgggcta
attacccttgagaccgataaagcaaccatggacgttccttcaacacacgcaggtacagtg
aaagaagtattcatcagcactggcgataaagtgaaagaaggtacggtagtgatcaagctt
gaagtagctggttcaggctcgtcttcaagtgagtcggcgtctagcgaagcttcttctgaa
gcgtctgcaccggctgcgcaggaaagtgaaaagcaagaatcagcgccagcggcgtctgca
ggtagcgagactattgaagttgctgtacctgatattggtgaagacggtgaagttgacgtt
atcgatgtacttgtatcagctggcgataccgttgaaaaagaagacggtcttatcacgcta
gaaaccgataaagcgactatggatgtaccttcaacacatgcaggtactattaaggaagtc
ttcatcaaagcgggtgacaaggttaagcagggcaccttggttgttaagcttgaaactagc
ggtggttcgtcttcaaatgcagcagaaaagcctgctgaagcgcctaaacaagactcacag
caagaagagtctaaacaagcgtcacagcaagaagcgtcgcaaggtcgttctcctgtgccg
ccagcgcctgaagctaagaatacaggtaaagcacatgcttctccttcggttcgccgtatt
gctcgcgagtttggtgtagatcttactcaagttaacggttctggccctaagaaccgtata
ttgaaagaagacgttcaagcttacgtgaaagctgagcttgcgaaacctcgcacagcagcc
gcttctggcagtgcgccagtaggcgacaacgtacttcaaatcgtgccggttaagcctgtt
gatcacagcaagtttggcgagattgaagagcaaaaactttctcgaattcaaaagatctct
ggaccgttcttacaccgtaactgggcgactatcccgcacgttacgcagttcgacgaagca
gatatcactgaagttgaagaattccgtaaagagcaaaacgcttaccacgcgaaaattaag
tctggtcttaagatcacgccattagtattcgtcatgaaagcggtagcgaaagcccttgag
aaatacgaagtatttaactcatcactgtctgacgacggtgagagcctaatcattaagaaa
tttatcaacattggtattgcggttgaaacaccgggaggccttgttgtacctgttattcgt
gacgtgaataagaaaggtattgagcagctttctcgcgagcttatcgaaacttctcaaaag
gcacgtgaaggcaagcttaaagcagccgacatgcaaggcggtacgttcaccatctctagt
ttaggtggtattggaggcacggcgtttacgcctattgtaaatgcaccagaagtcgccata
ttaggtgtgtctaagtctgagatgaagcctaagtggaatggtaaagagtttgagccgcgc
ttaatggtgccgctaagcttgtcttacgaccaccgagtaatcgatggtgcggtaggggca
agattctctaccgaggttgctgcaaacctaactgacttacgcagaatcatactttaa

DBGET integrated database retrieval system