KEGG   Actinosynnema mirum: Amir_0262Help
Entry
Amir_0262         CDS       T00957                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ami  Actinosynnema mirum
Pathway
ami00010  Glycolysis / Gluconeogenesis
ami00620  Pyruvate metabolism
ami00640  Propanoate metabolism
ami00680  Methane metabolism
ami01100  Metabolic pathways
ami01110  Biosynthesis of secondary metabolites
ami01120  Microbial metabolism in diverse environments
ami01130  Biosynthesis of antibiotics
ami01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amir_0262
   00620 Pyruvate metabolism
    Amir_0262
   00640 Propanoate metabolism
    Amir_0262
  Energy metabolism
   00680 Methane metabolism
    Amir_0262
Enzymes [BR:ami01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Amir_0262
Lipid biosynthesis proteins [BR:ami01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Amir_0262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACU34231
UniProt: C6WF99
Position
complement(284370..286355)
Genome map
AA seq 661 aa AA seqDB search
MTKPNENGPTLDNLLTESRTFPPSEEFAAQANATQALYDSAAADREAFWAEQADRLTWER
KWDRVLDWSDAPFAKWFVGGRLNVAYNCVDRHVESGHGEQVAIHWEGEPGDSRTITYADL
KRDVSKAANALASLGVGAEDRVAIYMPMVPEAIVAMLACARIGALHSVVFGGFSAEALRT
RVEDSQAKLVITTDGQYRRGNPAPLKPAVDEAVSKAASVEHVLVVRRTGGEVAWTEGRDL
WWHELVDGQSEEHAPEAFDSEHPLFILYTSGTTGNPKGILHTSGGYLTQTAYTHHNVFDL
KPDSDVYWCTADIGWVTGHSYIVYGPLANRVTQVVYEGTPNTPHEGRHWEIVQKYGVSIY
YTAPTLIRTFMKWGAEIPAKHDLSSLRVLGSVGEPINPEAWIWYRENIGAGKAPIVDTWW
QTETGAIMISPLPGVVSTKPGSAQRPLPGVGAKVVDDQGVEVGPGGGGYLVLDEPWPSML
RGIWGDDARYRDTYWSRFAEEGFYFAGDGAKYDADGDIWLLGRVDDVMNVSGHRISTTEV
ESALVSHPTVAEAAVVGATDPTTGQGIVAFVILRGGVAAGSDGAEAIKALRDHVAKEIGP
IAKPRQIMVVPELPKTRSGKIMRRLLRDVAENRQVGDVTTLADSSVMDLISSGLKKGSGE
D
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagccgaacgagaacggcccgaccctggacaacctgctgaccgagagccgcacg
ttccccccgtccgaggagttcgccgcgcaggcgaacgccacccaggcgctgtacgactcg
gccgccgccgaccgcgaggccttctgggccgagcaggccgaccggctgacctgggagcgg
aagtgggaccgggtcctcgactggtccgacgcaccgttcgccaagtggttcgtcggcggc
aggctcaacgtcgcctacaactgcgtcgaccggcacgtcgagtccggccacggcgagcag
gtcgccatccactgggagggcgagcccggcgacagccggaccatcacctacgccgacctc
aagcgcgacgtctccaaggccgccaacgcgctggcctcgctcggcgtcggcgccgaggac
cgggtcgccatctacatgccgatggtccccgaggcgatcgtcgccatgctggcctgcgcc
cgcatcggcgcgctgcacagcgtcgtgttcggcggcttctcggccgaggcgctgcgcacc
cgcgtcgaggactcgcaggccaagctggtgatcaccaccgacggccagtaccggcgcggc
aacccggccccgctcaagcccgccgtggacgaggccgtgtcgaaggccgcgagcgtcgag
cacgtgctggtggtgcggcgcaccggcggcgaggtggcctggaccgagggccgcgacctg
tggtggcacgagctggtggacggccagtccgaggagcacgcccccgaggcgttcgactcc
gagcacccgctgttcatcctctacacctcgggcaccaccgggaaccccaagggcatcctg
cacacctccggcggctacctcacgcagaccgcctacacgcaccacaacgtgttcgacctc
aagccggacagcgacgtctactggtgcaccgccgacatcggctgggtcaccgggcacagc
tacatcgtgtacggcccgctggccaaccgggtcacccaggtcgtctacgagggcaccccg
aacaccccgcacgagggccgccactgggagatcgtgcagaagtacggcgtctcgatctac
tacaccgcgccgacgctgatccgcacgttcatgaagtggggcgcggagatcccggccaag
cacgacctgtcgtcgctgcgggtgctcggcagcgtcggcgagccgatcaaccccgaggcg
tggatctggtaccgggagaacatcggcgcgggcaaggcgccgatcgtggacacctggtgg
cagaccgagaccggcgcgatcatgatctcgccgctgcccggcgtggtgtccaccaagccc
ggttcggcgcagcgcccgctgcccggcgtcggtgcgaaggtcgtggacgaccagggcgtc
gaggtcggccccggcggtggcggctacctggtgctggacgagccgtggccgtcgatgctg
cgcggcatctggggcgacgacgcgcgctaccgcgacacctactggtcgcggttcgccgag
gagggcttctacttcgcgggcgacggcgcgaagtacgacgcggacggcgacatctggctg
ctgggccgggtggacgacgtgatgaacgtgtccgggcaccggatctccaccaccgaggtg
gagtccgcgctggtgtcgcacccgaccgtggcggaggcggcggtggtcggggcgaccgat
ccgacgaccgggcagggcatcgtggcgttcgtgatcctgcgcggcggggtcgccgcgggc
tcggacggggccgaggcgatcaaggcgctgcgcgaccacgtggccaaggagatcgggccg
atcgcgaagcccaggcagatcatggtcgtgccggagctgccgaagacccgctcgggcaag
atcatgcgccgcctgctgcgcgacgtggcggagaaccgccaggtcggcgacgtgacgacg
ctggccgactcgtccgtgatggacctgatctcctccggcctgaagaagggctccggggag
gactga

DBGET integrated database retrieval system