KEGG   Actinosynnema mirum: Amir_0628Help
Entry
Amir_0628         CDS       T00957                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ami  Actinosynnema mirum
Pathway
ami00040  Pentose and glucuronate interconversions
ami00052  Galactose metabolism
ami00500  Starch and sucrose metabolism
ami00520  Amino sugar and nucleotide sugar metabolism
ami01100  Metabolic pathways
ami01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Amir_0628
   00052 Galactose metabolism
    Amir_0628
   00500 Starch and sucrose metabolism
    Amir_0628
   00520 Amino sugar and nucleotide sugar metabolism
    Amir_0628
Enzymes [BR:ami01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Amir_0628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Imm75
Motif
Other DBs
NCBI-ProteinID: ACU34591
UniProt: C6WJF9
Position
690808..691689
Genome map
AA seq 293 aa AA seqDB search
MSAFTTAIVPAAGLGTRFLPTTKAVPKELLPVVDTPGIELVATEAAEAGATKLIIVTSPG
KESVAQYFRPQPELEETLESRGKTDLVAKVRRAPALLDVETALQEKALGLGHAVGCAEAN
LTDADEAVAVLLPDDLVLPTGVLSRMAAVRDRFGGSVLCAFDIPREQISAYGVFDVNDTD
DDDVKQVVGMVEKPKAEDAPSTYAAAGRYLLDRAIFDALKRITPGAGGELQLTDAIALLI
SEGHPVHVVVHRGGRHDLGNPGGFLKAAVDFALEHPDYGPELGEWLRGRLGNS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccttcacgacagcaatcgtgcccgcggccgggttgggcacccgcttcctcccg
accaccaaggccgtgcccaaggagctgctgccggtcgtcgacacccccggcatcgaactc
gtcgccaccgaggcggccgaggcgggcgccaccaagctgatcatcgtcacctcccccggc
aaggagtcggtggcgcagtacttccgcccccagcccgagctggaggagaccctggagagc
cgcggcaagaccgacctggtcgccaaggtccgccgcgcccccgccctgctcgacgtggag
accgcgctccaggagaaggcgctcggcctcggccacgccgtcggctgcgccgaggccaac
ctgaccgacgccgacgaggccgtcgccgtgctgctgcccgacgacctggtgctccccacc
ggcgtgctctcccgcatggccgccgtccgcgaccgcttcggcggcagcgtgctgtgcgcg
ttcgacatcccgcgcgagcagatctccgcgtacggcgtgttcgacgtgaacgacaccgac
gacgacgacgtcaagcaggtcgtcggcatggtcgagaagcccaaggccgaggacgccccg
tccacctacgccgccgcgggccgctacctcctcgatcgggcgatcttcgacgccctcaag
cggatcacccccggcgcaggcggcgagctccagctcaccgacgccatcgcgctgctgatc
tccgagggccacccggtgcacgtcgtggtccaccgcggtgggcgacacgacctgggcaat
ccgggaggtttcctcaaggctgcggttgacttcgcgttggagcacccggactacgggccc
gagctcggtgagtggttgcggggtcgcctcggcaactcctga

DBGET integrated database retrieval system