KEGG   Actinosynnema mirum: Amir_1510Help
Entry
Amir_1510         CDS       T00957                                 

Definition
(GenBank) Polyphosphate--glucose phosphotransferase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
ami  Actinosynnema mirum
Pathway
ami00010  Glycolysis / Gluconeogenesis
ami00520  Amino sugar and nucleotide sugar metabolism
ami01100  Metabolic pathways
ami01110  Biosynthesis of secondary metabolites
ami01120  Microbial metabolism in diverse environments
ami01130  Biosynthesis of antibiotics
ami01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amir_1510
   00520 Amino sugar and nucleotide sugar metabolism
    Amir_1510
Enzymes [BR:ami01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Amir_1510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACU35461
UniProt: C6WAJ4
Position
complement(1668710..1669471)
Genome map
AA seq 253 aa AA seqDB search
MVMTRGFGVDIGGSGIKGGLVDLEMGALDGERLRIATPQPSTPDAVADVVAEIVEKFGWD
GPVGITLPCVVKRGVALSAANVDKGWIDTDAQALFARRLGRAADQVVVLNDADAAGVAEM
EFGAGVGKDGLVVLLTFGTGIGSAVFLDGKLVPNTEFGHLEVDGHDAEKRAAASVKEDKG
LSWAEWAPRVSRYVTVLENLIWPDLVIAGGGVSKKAEKWLPLLEVRTPVVAAALKNDAGI
VGAAVAATRGFQH
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggtcatgacccgcgggttcggcgtggacatcggcggctcgggcatcaagggcggtctg
gtggacctggagatgggcgcgctggacggtgagcggctgcgcatcgccacgccgcagccg
tccacgccggacgcggtagccgacgtggtcgcggagatcgtggagaagttcggctgggac
ggcccggtcggcatcaccctcccgtgcgtggtcaagcgcggtgtcgcgctgtccgcggcc
aacgtcgacaagggctggatcgacaccgacgcgcaggcgctgttcgcgcgcaggctcggt
cgggccgccgaccaggtggtggtgctcaacgacgcggacgcggcgggcgtcgccgagatg
gagttcggcgcgggggtgggcaaggacggcctggtcgtgctgctgaccttcggcaccggc
atcggcagcgccgtgttcctggacggcaagctcgtccccaacaccgagttcggccacctg
gaggtggacgggcacgacgcggagaagcgcgccgcggcctcggtgaaggaggacaagggg
ctgtcctgggccgagtgggcgcccagggtctcccggtacgtcaccgtgctggagaacctg
atctggcccgacctggtcatcgcgggcggcggggtgagcaagaaggcggagaagtggctc
cccctgctggaggtccgcaccccggtcgtggccgccgcgctgaagaacgacgcgggcatc
gtcggggcggcggtggccgccaccaggggcttccagcactga

DBGET integrated database retrieval system