KEGG   Actinosynnema mirum: Amir_3071Help
Entry
Amir_3071         CDS       T00957                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ami  Actinosynnema mirum
Pathway
ami00250  Alanine, aspartate and glutamate metabolism
ami01100  Metabolic pathways
ami01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Amir_3071
Enzymes [BR:ami01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Amir_3071
Peptidases [BR:ami01002]
 Cysteine Peptidases
  Family C44
   Amir_3071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700
Motif
Other DBs
NCBI-ProteinID: ACU36987
UniProt: C6W7W6
Position
3546155..3547993
Genome map
AA seq 612 aa AA seqDB search
MCGITGWVSHDSDLTTRPGAGDALAGMTATMACRGPDDSGTWWHPDAALGHRRLAVIDLP
GGRQPMVLPTPRGDLCLVYSGETYNHAELRAELTALGHTWRTASDTEVVLHGYLEWGERV
VEHLNGMYAFAVWDSRDRTLLLARDRMGVKPLYYRPTPDGVLFGSEPKAVLAHPLAERAV
DDDGLRELLLPTQRPGWSLWKDLVPVEPGTTVTVSRSGIRARTYWSLRTTPHADDRDTTV
ATVRELLTDTVRRQLVADVPRCVLLSGGLDSSAITGLAAAELTEPVRTFSVDFPGQEENF
APDDLRPTPDAPYVRDVVGLVGSDHHDVLLDPAHLTDPDTRRAVLTARDAPTGAGDLDVS
LHLLFKAIRADSTVALSGESADEVFGGYRWFHDGSAEVDGFPWMVAFRESGSGAASPYRA
DLMRRLDLGSYVRDEYRAAVARVEPLEGESAREARMRVVCHLHLTRFVRMLLDRKDRMSM
AVGLEVRVPFCDHRLVEYAYNAPWALKTFDGREKSLLRHATAHVLPASVRDRVKSPYPST
QDPGYAAALQRQVAQVLAEPGHPVFDLVDRERARLLVGTDPARVGPAQRFALDRVLDLSH
WFDLYRPRLLAS
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcaccgggtgggtctcccacgactccgacctcaccacgcgccccggcgcc
ggggacgccctggccgggatgaccgccaccatggcctgccgaggcccggacgactccggg
acctggtggcacccggacgccgccctcggccaccgcaggctcgccgtcatcgacctgccc
ggcggtcgccagccgatggtcctgcccaccccgcgcggcgacctctgcctggtctacagc
ggcgagacctacaaccacgccgagctgcgcgccgagctgaccgccctgggccacacctgg
cgcaccgccagcgacaccgaggtcgtcctgcacggctacctggagtggggcgagcgcgtc
gtcgagcacctcaacggcatgtacgccttcgccgtctgggactcccgcgaccggaccctc
ctgctggcccgcgaccgcatgggcgtcaaacccctctactaccgccccaccccggacggc
gtgctgttcggctccgagcccaaggcggtcctggcccacccgctggcggagcgcgccgtg
gacgacgacggcctgcgcgagctgctcctgcccacccagcggcccggctggtcgctgtgg
aaggacctcgtcccggtcgagcccggaaccaccgtcacggtcagccgctccgggatccgc
gcccgcacctactggtccctgcgcaccaccccgcacgccgacgaccgcgacaccaccgtc
gccaccgtccgcgagctgctcaccgacaccgtccgccgccagctcgtcgccgacgtgccc
cgctgcgtcctactctccggcggcctggactccagcgccatcaccggtctcgcggcggcc
gagctgaccgagccggtccgcaccttctccgtcgacttccccggccaggaggagaacttc
gccccggacgacctgcgccccacgccggacgcgccgtacgtccgcgacgtcgtcgggctc
gtcgggtccgaccaccacgacgtcctgctcgacccggcccacctcaccgacccggacacc
cgccgcgccgtcctcaccgcgcgcgacgcccccaccggcgcgggggacctggatgtgtcg
ctgcacctgctgttcaaggcgatccgggcggactcgaccgtggcgctgtcgggggagtcg
gcggacgaggtgttcggcggctaccgctggttccacgacggctcggccgaggtcgacggg
ttcccctggatggtcgcgttccgggagtcgggctccggcgcggcctccccgtaccgggcg
gacctgatgcgacgcctggacctgggctcctacgtccgggacgagtaccgcgcggccgtg
gcgcgggtcgagccgctggagggcgagtcggcgcgcgaggcgcggatgcgcgtggtgtgc
cacctgcacctgacccggttcgtgcggatgctgctggaccgcaaggaccgcatgtccatg
gccgtgggcctggaggtgcgcgtcccgttctgcgaccaccggctggtcgagtacgcctac
aacgcgccctgggcgctgaagaccttcgacggcagggagaagagcctgctgcgccacgcc
accgcgcacgtgctgcccgcgtcggtgcgcgaccgcgtgaagagcccgtacccgtcgacc
caggaccccggttacgccgcggccctgcagcggcaggtcgcccaggtgctcgccgaaccg
gggcacccggtgttcgacctcgttgaccgggagcgggcgcggctgctggtcgggaccgac
cccgcgcgggtgggcccggcgcagcgcttcgccctcgaccgggtgctggacttgagccac
tggttcgacctctaccggccgcgcctgctcgcgtcctga

DBGET integrated database retrieval system