KEGG   Actinosynnema mirum: Amir_3429Help
Entry
Amir_3429         CDS       T00957                                 

Definition
(GenBank) Amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
ami  Actinosynnema mirum
Pathway
ami00330  Arginine and proline metabolism
ami00360  Phenylalanine metabolism
ami00380  Tryptophan metabolism
ami00627  Aminobenzoate degradation
ami00643  Styrene degradation
ami01100  Metabolic pathways
ami01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ami00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Amir_3429
   00360 Phenylalanine metabolism
    Amir_3429
   00380 Tryptophan metabolism
    Amir_3429
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Amir_3429
   00643 Styrene degradation
    Amir_3429
Enzymes [BR:ami01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     Amir_3429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ACU37326
UniProt: C6W9V9
Position
complement(3996197..3997570)
Genome map
AA seq 457 aa AA seqDB search
MDLTDACFAGAAAQADLLRSGVLTSRELVSECLRRIERVDRGLNAFRLVFAERALADAEA
ADARRARGGDAPLLGVPVAVKEDFALAGLPTTLGTSAVETVADADSEVVSLLRGAGAVVV
GRTRMPELGLWPFTESSWAGPTRNPWSPRHSAGGSSGGSAAAVAAGLVGAAVGTDGGGSV
RIPAAATGLVGLKTQRGRVPLGGQPWGGLVAAGPITRRVRDAALLADVLAPGEDFVGAAA
EDPGRLKVAVALRPWSAGVPVAREVLDAVLDTAVLLTDLGHEVVRLDAALAEVPGWVDFS
VRYLRDGAAGGVAALDRPDRLDRRTRRVAAMGRAIPAAVGAAAVASGRGTTERANRVFTR
YDVLLSPVLTHPALRVGQWRELTAVEALLAAARHTAFLPVWNVAGNPAVAVPAGFTGAGL
PLSVQLVGRPHDERTVLSVAGQLERARPWADRRPPVG
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggatctgaccgacgcgtgcttcgcgggcgccgccgcccaggccgacctgctgcgctcc
ggggtgctgacctcccgcgagctggtgtccgagtgcctgcggcggatcgagcgcgtcgat
cgggggctcaacgcgttccggctggtgttcgccgagcgggcgctcgcggacgccgaggcc
gccgacgcgcggcgggcgcggggtggggacgcgccgctgctgggggtgccggtggcggtg
aaggaggacttcgcgctggccgggctgcccaccacgctgggcacctcggcggtggagacg
gtcgcggacgcggacagcgaggtggtgtcgctgctgcgcggggcgggcgcggtggtggtg
gggcgcacgcggatgccggaactggggctgtggccgttcaccgagagcagctgggccggg
cccacccgcaacccgtggtcgccccgccactcggccgggggttccagcggcgggtccgcg
gcggcggtggcggccgggctggtgggggccgcggtgggcacggacggcgggggttcggtg
cgcatcccggcggcggcgaccgggctggtggggctcaagacgcagcgcgggcgggtgccg
ctgggcgggcagccgtggggcgggctggtggcggcggggccgatcacgcggcgggtgcgg
gacgcggcgctgctggcggacgtgctcgcgcccggcgaggacttcgtgggggccgcggcc
gaggaccccggccggttgaaggtggcggtggcgctgcggccgtggtcggcgggggtgccg
gtggcgcgggaggtgctggacgcggtgctggacaccgccgtgctgctgaccgacctgggg
cacgaggtggtgcggctggacgcggcgctggcggaggtgccgggatgggtggacttctcg
gtgcgctacctgcgcgacggggccgcaggcggggtggcggcgctggaccggccggaccgc
cttgaccggcgcacccggcgggtcgcggcgatggggcgggcgatcccggccgccgtgggg
gcggcggcggtggcgtccggcaggggcacgaccgagcgggcgaaccgggtgttcacccgc
tacgacgtgctgctgagcccggtgctcacccacccggcgctgcgggtggggcagtggcgg
gagctgacggcggtggaggcgctgctcgcggcggcccggcacaccgcgttcctgccggtg
tggaacgtggcgggcaacccggcggtggcggtcccggcggggttcaccggcgcggggctg
ccgctgtcggtgcagctggtcgggcgcccgcacgacgagcggacggtgctgtcggtggcg
gggcagctggagcgggcccggccgtgggcggaccgcaggccgccggtggggtga

DBGET integrated database retrieval system