KEGG   Actinosynnema mirum: Amir_5197Help
Entry
Amir_5197         CDS       T00957                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ami  Actinosynnema mirum
Pathway
ami00010  Glycolysis / Gluconeogenesis
ami00051  Fructose and mannose metabolism
ami00562  Inositol phosphate metabolism
ami01100  Metabolic pathways
ami01110  Biosynthesis of secondary metabolites
ami01120  Microbial metabolism in diverse environments
ami01130  Biosynthesis of antibiotics
ami01200  Carbon metabolism
ami01230  Biosynthesis of amino acids
Module
ami_M00002  Glycolysis, core module involving three-carbon compounds
ami_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amir_5197
   00051 Fructose and mannose metabolism
    Amir_5197
   00562 Inositol phosphate metabolism
    Amir_5197
Enzymes [BR:ami01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Amir_5197
Exosome [BR:ami04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Amir_5197
  Exosomal proteins of bladder cancer cells
   Amir_5197
  Exosomal proteins of melanoma cells
   Amir_5197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACU39018
UniProt: C6W8H1
Position
complement(6192700..6193485)
Genome map
AA seq 261 aa AA seqDB search
MARTPLIAGNWKMNLNHLEAIALVQKIAFALPEKYYAKVEVAVLPPFTDIRSVQTLVDGD
KLLLKYGAQDLSPHDSGAYTGDISGVMLAKLGCSYVTVGHSERRDYHGEDDATVNKKVKA
ALKHGITPIFCLGEKVDVREKGEHVAFCTDQLVAGLKGLTAEQVRGVVIAYEPVWAIGTG
KVASAADAQEVCSALRVKLAEAYGEDVASEVRVLYGGSVKSGSVGELIAQKDVDGALVGG
ASLDGDEFSKLCALAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgcactccgctgatcgcgggcaactggaagatgaatctgaaccacctggaggcc
atcgccctggtgcagaagatcgccttcgcgctgcccgagaagtactacgccaaggtcgag
gtggcggtgctcccgccgttcaccgacatccgcagcgtgcagaccctcgtcgacggcgac
aagctcctgctcaagtacggcgcgcaggacctgtccccgcacgactcgggcgcctacacc
ggcgacatctcgggcgtgatgctcgcgaagctcggctgctcctacgtcaccgtgggccac
tccgagcggcgcgactaccacggcgaggacgacgcgaccgtcaacaagaaggtcaaggcc
gccctcaagcacgggatcaccccgatcttctgcctcggcgagaaggtcgacgtgcgggag
aagggcgagcacgtcgccttctgcaccgaccagctcgtcgccggcctcaagggcctgacc
gccgagcaggtgcgcggcgtcgtcatcgcctacgagcccgtgtgggccatcggcaccggc
aaggtcgccagcgcggccgacgcgcaggaggtctgctcggcgctgcgggtcaagctggcc
gaggcgtacggcgaggacgtcgcgtccgaggtccgggtgctctacggcggctcggtgaag
tccggcagcgtcggcgagctgatcgcgcagaaggacgtcgacggcgccctcgtgggcggc
gcgagcctggacggcgacgagttcagcaagctctgcgcgctcgccgcgggtggtccccta
ccctga

DBGET integrated database retrieval system