KEGG   Actinosynnema mirum: Amir_5973Help
Entry
Amir_5973         CDS       T00957                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
ami  Actinosynnema mirum
Pathway
ami00020  Citrate cycle (TCA cycle)
ami00620  Pyruvate metabolism
ami01100  Metabolic pathways
ami01120  Microbial metabolism in diverse environments
ami01200  Carbon metabolism
ami01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ami00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Amir_5973
   00620 Pyruvate metabolism
    Amir_5973
Enzymes [BR:ami01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     Amir_5973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C Biotin_lipoyl_2 ATP-grasp RnfC_N ATP-grasp_3 HlyD_D23 NQRA GCV_H AstE_AspA
Motif
Other DBs
NCBI-ProteinID: ACU39781
UniProt: C6WF06
Position
complement(7015428..7018805)
Genome map
AA seq 1125 aa AA seqDB search
MFRKVLVANRGEIAIRAFRAAYELGAGTVAVFPHEDRNSLHRLKADESYEIGEPGHPVRA
YLSVDEVIKAARKAGADAVYPGYGFLSENPGLAKACADAGITFVGPPTEVLELTGNKASA
IAAARAAGLPVLKSSDPSSDVDALLAAADDIGFPVFVKAVAGGGGRGMRRVEDPAALRES
IEAASREAESAFGDPTVFLEQAVVEPRHIEVQILADGQGGVIHLFERDCSVQRRHQKVIE
IAPAPNLSPELRERICGDAVRFAEHIGYRNAGTVEFLLDPRGNYVFIEMNPRIQVEHTVT
EEVTDVDLVQSQMRIASGETLADLGLSQDTVQLRGAALQCRITTEDPANGFRPDTGMISA
YRSPGGSGVRLDGGTTGVGTAISAHFDSMLVKLTCRGRTFSAAVARARRAVAEFRIRGVS
TNIPFLQAVLDDPDFYEGRVTTSFIEKRPHLLTARSSADRGTRLLTYLADVTVNRPNGAR
PSVVDPRLKLPPVDVSSDPAPGSKQRLDQLGPEGFARWLRSSERVGVTDTTFRDAHQSLL
ATRVRTKDLLAVAPHVARLTPELLSLEAWGGATYDVALRFLAEDPWERLAALREAVPNIA
LQMLLRGRNTVGYTPYPEAVTSAFVEEATATGIDIFRIFDALNDVEQMRPAIEAVRATGT
AVAEVALCYTADLSNPDERLYTLDYYLRLAEQIVSAGAHVLAVKDMAGLLRPPAAAKLIT
ALRSEFDLPVHLHTHDTAGGQLATYLAAIQSGVDAVDGAAASMGGTTSQPPLSAIVAATD
HTPHATGLDLAAVCDLEPYWESVRKVYAPFESGIPGPTGRVYSHEIPGGQLSNLRTQAVA
LGLGQKFEEIEAMYAAADRMLGRLVKVTPSSKVVGDLALHLVGAGVSPAEFEAEPGRFDV
PGSVIGFLHGELGDPPGGWPEPFRSKALKGRAAPKAVAELTEDDRKGLAEKPRATLNRLL
FPAPTKEYLAHRDAYGDTSVLSSKDFFYGLRPGEEYPVDLEPGVRLLIRLEAIGEADERG
VRTVMAVLNGQLRPIQVRDRSVAAEVPAAEKADRANPNHVAAPFSGVVQPSVAEGDEVDA
GQTLATIEAMKMEAAITAPKAGRVARLAVGNVQQVEGGDLLVVLE
NT seq 3378 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcaaggtacttgtcgccaaccgcggcgagatcgccatccgggcgttccgcgcc
gcttacgagctgggcgcgggcacggtcgccgtcttcccccacgaggaccgcaactccctg
cacaggctgaaggcggacgagtcctacgagatcggcgagcccggccacccggtgcgggcg
tacctgtccgtcgacgaggtcatcaaggccgcgcgcaaggcgggcgccgacgccgtgtac
cccggttacggcttcctctccgagaaccccggactggccaaggcctgcgccgacgcgggg
atcacgttcgtgggtccccccaccgaggtgctggagctgaccggcaacaaggccagcgcc
atcgccgccgcccgcgccgccgggctgcccgtgctcaagtccagcgacccgtccagcgac
gtcgacgcgctgctcgcggcggccgacgacatcggcttcccggtgttcgtcaaagccgta
gcgggcggcggcgggcgcgggatgcggcgcgtcgaggacccggccgccctgcgcgagtcg
atcgaggccgcgtcccgcgaggccgagtccgccttcggggacccgacggtgttcctggag
caggccgtcgtcgagccccggcacatcgaggtgcagatcctcgcggacgggcagggcggc
gtgatccacctgttcgagcgcgactgctcggtgcagcgcaggcaccagaaggtcatcgag
atcgcgcccgccccgaacctctcgccggagctgcgcgagcggatctgcggcgacgcggtc
aggttcgccgagcacatcgggtaccgcaacgcgggcaccgtcgagttcctgctcgacccg
cgcgggaactacgtgttcatcgagatgaacccgcgcatccaggtcgagcacacggtcacc
gaggaggtcaccgacgtcgacctcgtgcagtcccagatgcgcatcgcctccggcgagacc
ctcgcggacctcggcctgagccaggacaccgtgcagctgcgcggcgccgcgctccagtgc
cgcatcaccaccgaggaccccgccaacgggttccgcccggacaccggcatgatcagcgcc
taccgctcgcccggcggctccggcgtgcgcctggacggcggcaccaccggcgtcggcacg
gccatcagcgcccacttcgactcgatgctggtcaagctgacctgccggggccgcacgttc
tccgccgccgtcgcccgcgcccggcgcgcggtcgccgagttccgcatccggggcgtgtcc
acgaacatcccgttcctgcaggcggtgctggacgacccggacttctacgagggccgcgtc
accacctcgttcatcgagaagcgcccgcacctgctgaccgcgcgctcctccgcggaccgg
gggacgcgcctgctgacgtacctggccgacgtgacggtgaaccggccgaacggcgcccgg
ccgtccgtcgtggacccgaggctgaagctgccgcccgtcgacgtgtcctccgacccggcg
cccggcagcaagcagcgcctggaccagctcgggcccgaggggttcgcgcggtggctgcgc
tccagcgagcgcgtcggcgtcaccgacaccacgttccgcgacgcgcaccagtcgctgctg
gccacgcgcgtgcgcaccaaggacctgctcgccgtcgcgccgcacgtcgcgcggctcacg
cccgagctgctgtcgctggaggcgtggggcggggcgacctacgacgtggcgctgcggttc
ctcgccgaggacccgtgggagcggctggccgcgctgcgcgaggcggtgccgaacatcgcg
ctgcagatgctgctgcgcgggcgcaacacggtcgggtacacgccgtaccccgaggcggtg
accagcgccttcgtcgaggaggccaccgcgaccggcatcgacatcttccgcatcttcgac
gcgctgaacgacgtcgagcagatgcggcccgcgatcgaggcggtgcgcgccaccggcacg
gccgtcgccgaggtcgcgctctgctacaccgccgacctgtccaacccggacgagcggctc
tacacgctcgactactacctgcggctggccgagcagatcgtgtcggcgggcgcgcacgtg
ctcgcggtgaaggacatggccgggctgctccgcccgcccgccgccgcgaagctcatcacc
gcgctgcgcagcgagttcgacctgccggtgcacctgcacacccacgacaccgccggtggc
cagctggccacgtacctggcggcgatccagtccggggtggacgcggtggacggcgcggcg
gcgtcgatgggcggcaccacctcgcagccgccgctgtcggcgatcgtggcggcgaccgac
cacaccccgcacgcgaccggcctggacctggcggcggtgtgcgacctggagccgtactgg
gagtcggtgcggaaggtgtacgcgccgttcgagtccggcatccccggcccgacggggcgg
gtgtacagccacgagatccccggcggccagctgtcgaacctgcgcacccaggcggtggcg
ctcgggctggggcagaagttcgaggagatcgaggcgatgtacgccgccgccgaccggatg
ctcggcaggctggtgaaggtgacgccgtcgtccaaggtggtcggcgacctggccctgcac
ctggtcggcgccggggtgagcccggccgagttcgaggccgagccgggcaggttcgacgtg
ccgggttccgtcatcggcttcctgcacggcgagctgggcgacccgcccggcggctggccg
gagccgttccgcagcaaggcactgaagggcagggcggccccgaaggcggtcgcggagctg
accgaggacgaccgcaagggcctggccgagaagccccgcgcgaccctgaaccggttgctg
ttcccggcgcccaccaaggagtacctggcgcaccgggacgcgtacggcgacacgagcgtg
ctgagcagcaaggacttcttctacggcctgcggccgggcgaggagtacccggtggacctg
gagccgggcgtgcgcctgctgatccgcctggaggcgatcggcgaggcggacgagcgcggg
gtccgcaccgtgatggcggtcctgaacggccaactccgcccgatccaggtgcgcgaccgc
tcggtcgcggcggaggtcccggcggcggagaaggcggaccgcgccaacccgaaccacgtg
gcggccccgttctcgggcgtggtccagccgtcggtcgcggagggcgacgaggtcgacgcg
gggcagaccctggcgacgatcgaggcgatgaagatggaggccgcgatcaccgcgccgaag
gcgggtcgggtggcgcggttggcggtggggaacgtgcagcaggtcgaaggcggggatctg
ctggtggtgttggagtag

DBGET integrated database retrieval system