KEGG   Actinosynnema mirum: Amir_6065Help
Entry
Amir_6065         CDS       T00957                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ami  Actinosynnema mirum
Pathway
ami00071  Fatty acid degradation
ami00280  Valine, leucine and isoleucine degradation
ami00281  Geraniol degradation
ami00310  Lysine degradation
ami00360  Phenylalanine metabolism
ami00362  Benzoate degradation
ami00380  Tryptophan metabolism
ami00410  beta-Alanine metabolism
ami00627  Aminobenzoate degradation
ami00640  Propanoate metabolism
ami00650  Butanoate metabolism
ami00903  Limonene and pinene degradation
ami00930  Caprolactam degradation
ami01100  Metabolic pathways
ami01110  Biosynthesis of secondary metabolites
ami01120  Microbial metabolism in diverse environments
ami01130  Biosynthesis of antibiotics
ami01212  Fatty acid metabolism
Module
ami_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Amir_6065
   00650 Butanoate metabolism
    Amir_6065
  Lipid metabolism
   00071 Fatty acid degradation
    Amir_6065
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Amir_6065
   00310 Lysine degradation
    Amir_6065
   00360 Phenylalanine metabolism
    Amir_6065
   00380 Tryptophan metabolism
    Amir_6065
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Amir_6065
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Amir_6065
   00281 Geraniol degradation
    Amir_6065
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Amir_6065
   00627 Aminobenzoate degradation
    Amir_6065
   00930 Caprolactam degradation
    Amir_6065
Enzymes [BR:ami01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Amir_6065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 SDH_sah
Motif
Other DBs
NCBI-ProteinID: ACU39872
UniProt: C6WGA8
Position
complement(7117322..7118101)
Genome map
AA seq 259 aa AA seqDB search
MAEFARLEVSDGIGTIRLDRPPMNALNRQVQEEIRAAATEASARADVRAVVVYGGPKVFA
AGADIKEMADLSYAEMAERAAGFSSALRAVEEIPKPTVAAITGYALGGGFELALCADRRI
AGDNAKVGQPEILLGVIPGMGGTQRLPRLIGPSRAKDLIYTGRFVGAEEALRIGMVDEVV
APDDVHAAALRWAGQFTAGPARAYAAAKAAIDGGLDTDLGSGLRLETQLFAAMFATEDQK
TGMRSFIENGPGKAKFSGK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagttcgcacggctcgaagtctccgacgggatcggaaccatccggctcgaccgg
ccgccgatgaacgccctcaaccggcaggtccaggaggagatcagggccgccgccaccgag
gcgtccgcgcgggccgacgtgcgcgcggtggtcgtctacggcggtccgaaggtgttcgcg
gcgggcgcggacatcaaggagatggccgacctgtcctacgccgagatggccgagcgcgcc
gccgggttcagctcggcgctgcgggccgtcgaggagatcccgaagccgaccgtcgcggcc
atcaccggctacgcgctcggcggcgggttcgagctggcgctgtgcgcggaccggcggatc
gcgggcgacaacgccaaggtcgggcagcccgagatcctgctcggcgtcatccccggcatg
ggcggcacgcagcggctgccccggctgatcgggccgtcccgcgccaaggacctgatctac
accggccggttcgtcggcgccgaggaggcgctgcgcatcggcatggtcgacgaggtggtg
gccccggacgacgtgcacgccgccgcgctgcggtgggccgggcagttcacggccgggccc
gcgcgggcctacgccgccgccaaggccgcgatcgacggcgggctggacaccgacctcggc
agcgggctccggctggagacccagctgttcgcggcgatgttcgccaccgaggaccagaag
accggcatgaggtcgttcatcgagaacgggcccggaaaggcgaagttcagtggcaagtga

DBGET integrated database retrieval system