KEGG   Actinosynnema mirum: Amir_6508Help
Entry
Amir_6508         CDS       T00957                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ami  Actinosynnema mirum
Pathway
ami00020  Citrate cycle (TCA cycle)
ami00640  Propanoate metabolism
ami00660  C5-Branched dibasic acid metabolism
ami01100  Metabolic pathways
ami01110  Biosynthesis of secondary metabolites
ami01120  Microbial metabolism in diverse environments
ami01130  Biosynthesis of antibiotics
ami01200  Carbon metabolism
Module
ami_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ami_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Amir_6508
   00640 Propanoate metabolism
    Amir_6508
   00660 C5-Branched dibasic acid metabolism
    Amir_6508
Enzymes [BR:ami01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Amir_6508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ACU40308
UniProt: C6WLS3
Position
complement(7645043..7646212)
Genome map
AA seq 389 aa AA seqDB search
MDLYEYQAKDLFAAHGVPVLPGEVASTPAEAKAIAEQLGTTVVVKAQVKTGGRGKAGGVK
LATTPAETEEKATGILGLDIKGHTVHRVLVTPASDIAEEYYFSFLLDRANRTFLAMASVE
GGMEIEEVAVKNPEALAKIAIDAVEGVDRAKADEIVAAAKFPAEVADQVADTIVKLWETF
VAEDATLVEVNPLVRDPEGKIVALDGKVTLDDNASFRHPAHAELVDKQAEDPLEAKAKEK
DLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGEKHKGVKPANFLDIGGGASAEVMANGLE
IILGDADVRSVFVNVFGGITSCDAVANGIVKALEILGDEATKPLVVRLDGNNVEEGRRIL
AEANHPLVTVVDTMDNAADKAAELAAAGV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgtacgagtaccaggcgaaggacctcttcgccgcccacggagtcccggtgctg
ccgggcgaagtggcgagcacccccgccgaggccaaggccatcgccgagcagctcggcacc
accgtcgtcgtcaaggcccaggtcaagacgggcggccggggcaaggcgggcggcgtcaag
ctggccacgaccccggccgagaccgaggagaaggccaccggcatcctcgggctggacatc
aagggccacaccgtgcaccgcgtgctggtgacccccgcgtccgacatcgccgaggagtac
tacttctcgttcctgctggaccgcgcgaaccgcaccttcctcgccatggcctccgtcgag
ggcggcatggagatcgaggaggtcgcggtcaagaaccccgaggccctcgccaagatcgcg
atcgacgcggtcgagggcgtggaccgggcgaaggccgacgagatcgtcgccgccgccaag
ttcccggcggaggtggccgaccaggtcgccgacaccatcgtcaagctgtgggagaccttc
gtcgcggaggacgccacgctcgtcgaggtcaacccgctggtccgcgaccccgagggcaag
atcgtcgccctcgacggcaaggtcacgctggacgacaacgcctccttccgccacccggcg
cacgccgagctggtcgacaagcaggccgaggacccgctcgaggccaaggccaaggagaag
gacctcaactacgtcaagctcgacggccaggtcggcatcatcggcaacggcgccgggctg
gtcatgtccacgctcgacgtcgtcgcctacgccggtgagaagcacaagggcgtcaagccc
gcgaacttcctcgacatcggcggcggcgcgtccgccgaggtcatggccaacggcctggag
atcatcctgggcgacgcggacgtgcgcagcgtgttcgtgaacgtcttcggcggcatcacc
tcgtgcgacgccgtcgccaacggcatcgtcaaggccctggagatcctgggcgacgaggcc
accaagccgctggtcgtccgcctcgacggcaacaacgtcgaagagggccgccgcatcctg
gccgaggcgaaccacccgctcgtgaccgtggtggacactatggacaacgcggccgacaag
gccgccgagctcgcggctgcgggggtctga

DBGET integrated database retrieval system