KEGG   Aminipila sp. CBA3637: Ami3637_07705
Entry
Ami3637_07705     CDS       T06414                                 

Definition
(GenBank) ornithine aminomutase
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
amic  Aminipila sp. CBA3637
Pathway
amic00472  D-Arginine and D-ornithine metabolism
amic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amic00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Ami3637_07705
Enzymes [BR:amic01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Ami3637_07705
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A DUF2067 Vps8 DUF1450
Other DBs
NCBI-ProteinID: QHI73939
UniProt: A0A6P1MGU0
Position
1615026..1615379
AA seq 117 aa
MRREDDFQERRKHIANLTDEELYARFWELTAQVVDPLLELGRKNTTPSVERAVLLRMGIS
SLDTQKIVEGCMDRGLMGHGTGHVVYKLSKEKGISIRETGAMLAKGECWDEAVALFK
NT seq 354 nt   +upstreamnt  +downstreamnt
atgagaagagaagatgattttcaggaaagacgtaaacacattgcgaatcttactgacgaa
gaactttatgccagattttgggaactaactgcacaggtagttgatcccctacttgaatta
ggcagaaaaaacacaacaccttctgttgaaagagcagtactgttaagaatgggcatttct
tcacttgacacacagaaaatcgttgaaggttgcatggacagaggcctgatgggtcatggt
acaggtcatgttgtatataagttatccaaggaaaaaggcatttccatcagagaaactgga
gcaatgctggccaaaggtgaatgctgggatgaagcagtagctttgtttaaataa

DBGET integrated database retrieval system