KEGG   Aminobacter sp. MSH1: CO731_00033Help
Entry
CO731_00033       CDS       T05420                                 

Gene name
metK
Definition
(GenBank) S-adenosylmethionine synthase
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00270  Cysteine and methionine metabolism
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CO731_00033 (metK)
Enzymes [BR:amih01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     CO731_00033 (metK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N
Motif
Other DBs
NCBI-ProteinID: AWC20593
UniProt: A0A2S0XC15
Position
complement(34204..35487)
Genome map
AA seq 427 aa AA seqDB search
MSRQNYLFTSESVSEGHPDKVCDRISDEIVDLVYREAKKTGMDPWKVRVACETLATTNRV
VIAGEVRVPDTLLKKDKNGQIVKDAAGHPVVNPSKFKSVARKAIRAIGYEQAGFHWKTAK
IDVLLHGQSPDIGQGVDNAADRQGEEGAGDQGIMFGYACRETPDLMPAPIYYSHKILELL
ATARHENKGDAGMLGPDAKSQVTVRYQDGKAREVTQIVLSTQHLDGSWDSGKVRKVVEPY
IREALGDLEIANDCNWYINPTGKFVIGGPDGDAGLTGRKIIVDTYGGAAPHGGGAFSGKD
TTKVDRSAAYAARYLAKNVVAARLADRCTIQLAYAIGVAQPLSVYVDLHGTGKVDEAVLE
DALRQVMDLSPSGIRRHLDLNKPIYAKTSSYGHFGRKAGRDGSFSWEKTDLVKALKDAVA
SKEAVAA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcggcagaattatcttttcacttccgaatccgtatccgaaggtcaccccgacaag
gtgtgcgaccgcatttccgacgagatcgtcgatctcgtctaccgtgaagccaagaagacc
ggcatggatccgtggaaggtccgggttgcctgtgagaccctggcaaccaccaaccgcgtc
gtgatcgccggcgaagttcgcgtgcccgacacgctgctgaagaaagacaagaacggccag
atcgtgaaggacgccgctggccatccggtcgtcaatccgtcgaagttcaagtcggtggcc
cgcaaggccatccgcgccatcggctacgagcaggccggcttccactggaagaccgccaag
atcgacgtgctgctgcacggccagtcgcccgacatcggccagggcgtcgacaacgccgcc
gaccgccagggcgaagaaggtgccggtgaccagggcatcatgttcggttatgcctgccgc
gagacaccggacctgatgccggctccgatctactacagccacaagattctcgaactgctg
gccaccgcccggcacgagaacaagggcgacgcaggcatgctcggcccggacgccaagagc
caggtcaccgtccgctaccaggacggcaaggcccgcgaagtcacgcagatcgtgctttcg
acccagcacctcgacggcagctgggattcgggcaaggttcgcaaggtggtcgagccctac
atccgcgaagcccttggcgatctcgagatcgccaatgactgcaactggtacatcaacccg
accggcaagttcgtcatcggcggtccagacggcgacgcgggtctcaccggccgcaagatc
atcgtcgacacctatggcggcgctgccccgcatggcggcggtgcgttctccggcaaggac
accaccaaggtcgaccgttcggcagcctatgccgcgcgctacctggccaagaacgtggtt
gccgcccggcttgccgaccgctgcaccatccaactggcctatgccatcggtgttgcccag
ccgctgtcggtctatgtcgacctgcacggcaccggcaaggttgacgaagcggtgctcgaa
gacgcgctgcgccaggtcatggacctgtcgccgtctggcatccgccgccacctcgacctc
aacaagccgatctatgccaagacctcgtcctacggccacttcggccgcaaggctggtcgc
gacggttccttctcctgggagaagaccgacctggtcaaggcgctcaaggacgccgtagcc
agcaaggaagcggtcgccgcctga

DBGET integrated database retrieval system