KEGG   Aminobacter sp. MSH1: CO731_00258Help
Entry
CO731_00258       CDS       T05420                                 

Gene name
gndA
Definition
(GenBank) 6-phosphogluconate dehydrogenase, NADP(+)-dependent, decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00030  Pentose phosphate pathway
amih00480  Glutathione metabolism
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01120  Microbial metabolism in diverse environments
amih01200  Carbon metabolism
Module
amih_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
amih_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CO731_00258 (gndA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CO731_00258 (gndA)
Enzymes [BR:amih01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     CO731_00258 (gndA)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     CO731_00258 (gndA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 F420_oxidored Shikimate_DH 3HCDH_N ApbA 2-Hacid_dh_C NAD_Gly3P_dh_N Sacchrp_dh_NADP NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: AWC20817
UniProt: A0A2S0XCQ1
Position
complement(250483..251901)
Genome map
AA seq 472 aa AA seqDB search
MEKAEIGLIGLGTMGSNLALNIAEKGHRIAVFNRTPAKTQAFVEQAGDLRNMIVPCASIA
ELAEAIRPPRPVIIMVLAGTPVDEQIAALRGVMSANDIVIDAGNANFRDTMRRFKELEGS
GLTFIGMGVSGGEEGARHGPSIMVGGTPESWTRVEDVLTAISAKFKGEPCAAWLGTDGAG
HFVKTIHNGIEYADMQMIAEIYGILRDGLGMKPKEIALVFAGWNKGRLESYLIEITASVL
EADDPTTGRPVVDIILDRAGQKGTGKWSVIEAQQLGIPATAIEAAVAARVLSSMKDERLA
AEKAYGANTLKFAGSRDEVLGDLELALFAGKIAAYAQGFAVMAGASKEFGWNLPMPTIAK
IWRAGCIIRSQFLDTIAEAFGKAEPSTNLLMVPAFVEMMGKAHPSLRRIVARAAEAGLPV
PALSSALAYFDSYRQGRGSTDLTQAQRDFFGAHGFERIDAPGAHHGPWGSGS
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagccgaaatcggactgatcgggctcggcacgatgggctcgaacctggcgctc
aacatcgccgaaaaaggccatcgcatcgccgtcttcaaccgcaccccggcgaagacccag
gctttcgtcgaacaggccggcgacctgcgcaacatgatcgtgccctgcgcctccatcgcg
gagctggccgaggccatccgcccgccgcgcccggtcatcatcatggtgctggcgggcacg
ccggtcgacgagcagatcgcagcgcttcgcggcgtcatgtcggccaacgacatcgtcatc
gacgccggtaatgccaacttccgcgacaccatgcgccgcttcaaggagctcgagggctcg
ggcctgaccttcatcggcatgggtgtctcgggcggcgaggagggcgcgcgccacggcccc
tcgatcatggtcggcggcacgcctgaatcctggacgcgcgtcgaagacgtgctgaccgcg
atatcggccaagttcaagggcgagccatgcgcggcctggctcggcaccgacggtgccgga
catttcgtcaagaccatccacaatggcatcgaatatgccgacatgcagatgatcgccgag
atctacggcatcctgcgcgacggcctcggcatgaagccgaaggagatcgcgctcgtattc
gccggctggaacaagggcaggctggagtcctacctgatcgagatcaccgcatccgtactc
gaagccgacgatcccacgaccggccgcccggtggttgacatcatcctcgaccgcgccggc
cagaagggcaccggcaagtggtcagtcatcgaggcgcagcagcttggcattccggcaacg
gcgatcgaggcggcggtggcggcgcgcgtgctgtcgtcgatgaaggacgaacggcttgcg
gcggagaaggcctatggcgccaacacgctgaagttcgcaggcagccgggacgaagtgctc
ggggacctggagctggcactgtttgccggcaagatcgctgcctacgcgcagggttttgcc
gtgatggccggcgcctcgaaggagttcggctggaacctgccgatgccgaccatcgccaag
atctggcgcgccggctgcatcatccgctcgcagttcctcgacaccatcgccgaagccttc
ggcaaggccgaaccgtcgaccaatcttctgatggtgccggccttcgtcgagatgatgggc
aaggcgcatccttcgctccgccgcatcgtcgcccgtgccgccgaggccggattgccggtg
ccggcgctgtcgtcggcgctggcctatttcgacagctatcgccagggccgcggctcgacc
gacctgacccaggcgcagcgtgacttcttcggcgcccacggtttcgagcgcatcgatgcg
cccggcgcacatcacggcccgtggggaagtggaagctag

DBGET integrated database retrieval system