KEGG   Aminobacter sp. MSH1: CO731_00454Help
Entry
CO731_00454       CDS       T05420                                 

Gene name
hnr
Definition
(GenBank) 6-hydroxynicotinate reductase
  KO
K20449  6-hydroxynicotinate reductase [EC:1.3.7.1]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00760  Nicotinate and nicotinamide metabolism
amih01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CO731_00454 (hnr)
Enzymes [BR:amih01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.1  6-hydroxynicotinate reductase
     CO731_00454 (hnr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T_C
Motif
Other DBs
NCBI-ProteinID: AWC21012
UniProt: A0A2S0XD84
Position
447168..448703
Genome map
AA seq 511 aa AA seqDB search
MNELSERFETHEAGDRQAGEKLRCDACPVMCYIAEGRTGACDRYGNFGGRIVRCDAVRVL
DYAVESGTPLVPFGGQAWDGELVNTGRRFVTAIGSGTTYPDYKPAPFIVSQEVEGVDLVT
VVTEGIFSYCGVKVKIDTDRHLGPETASVRAQGEAVGHVTTGEYGSQMLSLGGVHHLTGG
SKSEGRVTCETLLDLCNKKPVELTIDGGATVVVEAGKAPVIDGQTEHRMRVGCGSAAIGM
FATQWRGLVDEVVVVDDHITGVVSEHQAGKVLGWEDTGIKILGRKSTPGRYFKVSEPGLG
WGGTSISDPLSILGDWNAKKGARPGLTLLMVSTTGEQFAYYELDTELKPVEKPFPERLRK
SVGLIEDNCEPALCTVLFVGGAGGSLRAGVTENPVNLTRSVHGLKTYVTVGGAPVYVWPG
GGITLMVDVTRVPDGAFGYVPTPALVAPIEFTLRKDDYLLLGGHAAEIRSIGDVLARGGE
YFNERAEARAGADNPWPPLAQLRRAVPDGSP
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagctctccgaacgcttcgagacgcatgaggccggcgacaggcaggcgggcgaa
aagctgcgctgcgatgcctgccctgtcatgtgctacatcgccgagggccgcaccggcgcc
tgcgaccgttacggcaatttcggcggccgcatcgtgcgctgcgacgccgtgcgcgtgctc
gactacgcggtcgagagcggcacacccttggtgcccttcggcggccaggcctgggacggc
gagttggtcaacaccggccggcgtttcgtcaccgccatcggttccggcacgacttacccc
gactacaagccggctcccttcatcgtcagccaggaggtcgagggcgtcgacctggtgact
gtcgtcaccgaaggcatcttctcctactgcggcgtcaaggtgaagatcgacaccgaccgc
catctcggacctgaaacggcgagcgtgcgcgcgcagggcgaggcggtcggccatgtgacg
acgggcgaatacggctcgcagatgctgtcgctcggcggcgtgcaccatcttaccggcggt
tcgaaatccgagggacgggtgacctgcgagaccctgctcgacctttgcaacaagaagccg
gtggaactgaccatcgacggcggcgcgaccgtcgtcgtcgaggccggcaaggcgccggtc
atcgacggccagaccgaacaccgcatgcgcgtcggctgcggctcggcggccatcggcatg
ttcgccacgcaatggcgcgggctggtcgacgaggtggtggtggtcgacgatcacatcacc
ggtgtcgtttccgaacaccaggccggcaaggtgctgggctgggaagacacggggatcaaa
atcctcgggcggaaatccacgccggggcgctatttcaaggtctcggagcctgggctcggc
tggggcggcaccagtatctccgacccgctctccatcctcggcgactggaacgccaagaag
ggcgcccgccccgggcttacgctgctgatggtatcgacgacaggcgaacagttcgcctat
tacgagctcgataccgagctgaaaccggtcgaaaagccgttcccggagcggttgcgcaag
tcggttgggctgatcgaggacaattgtgagccggctttgtgcaccgtgctgttcgtcggc
ggcgcgggcggctcgctgcgcgccggggtcaccgaaaaccccgtcaacctgacccgctct
gtccatggcctgaagacctatgtgacggtcggcggcgcgccggtctatgtctggcctggg
ggcggcatcacgctgatggtcgacgtcacacgcgtgcccgatggcgccttcggctatgtg
ccgaccccggcgctggtggcgccgatcgagttcacgctgcgcaaggacgactacctgttg
ctcggcggacatgcggccgagatcaggagcatcggcgacgtgctcgcgcgcggcggcgaa
tatttcaacgagcgggcggaggcccgggccggtgccgacaatccctggccaccgctggcg
caactgcgccgggcggtgccggacggatcgccatga

DBGET integrated database retrieval system