KEGG   Aminobacter sp. MSH1: CO731_00755Help
Entry
CO731_00755       CDS       T05420                                 

Gene name
psdht_1
Definition
(GenBank) Phenylserine dehydratase
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00260  Glycine, serine and threonine metabolism
amih00290  Valine, leucine and isoleucine biosynthesis
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01130  Biosynthesis of antibiotics
amih01200  Carbon metabolism
amih01230  Biosynthesis of amino acids
Module
amih_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CO731_00755 (psdht_1)
   00290 Valine, leucine and isoleucine biosynthesis
    CO731_00755 (psdht_1)
Enzymes [BR:amih01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     CO731_00755 (psdht_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AWC21306
UniProt: A0A2S0XE23
Position
complement(786040..786987)
Genome map
AA seq 315 aa AA seqDB search
MYLPTLNDMRAARERISPYIHLTPILTSRMINELAGAELFFKCENLQKAGAFKARGASNA
VFSLSEEQARKGVATHSSGNHGTCLSYAAGRRGIPCTVVMPRTAPQAKKDAVVGYGGTVV
ECEPSTSSREAVFSEIVAKTGAEFVHPYNDHRVIAGQATCSAELIEQVDGLDAVVAPIGG
GGMVSGTCLTLSSLAPHLKIYAAEPEQADDAYRSFKAGHIIADDAPNTVADGLKVPLKDL
TWHFVRNFVTDIQTASEQEIVDAMKVIWKRLKIVMEPSSAVPLATILKNREVFAGKRVGV
IVTGGNVDLDKLPWN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtacctcccgacattgaacgacatgcgcgcggcgcgcgagcgcatctccccatacatt
catctcacaccaatattgacctcccgcatgatcaacgagctcgccggggcagaactcttc
ttcaagtgcgagaacttgcagaaggccggagcgttcaaggcccgcggcgcctcaaacgcc
gtctttagcctatccgaggaacaggcgcgcaagggtgtcgcaactcattcgagcggcaat
cacggaacctgcctaagctatgccgccggtcgacgtggcattccctgtacggtggtaatg
ccacgcaccgcaccccaggcgaagaaagacgccgtggtgggctatgggggaacggtcgtc
gagtgtgaaccatccacctcgagccgcgaagcggtgttttcagagatcgtcgcaaaaacg
ggagcagagtttgtccatccctataacgaccaccgcgtgattgcggggcaggccacctgt
tcggcagaactcattgagcaggtggatggtctggatgccgtcgtggcaccgatcggtgga
ggcgggatggtttcaggcacatgcctgacgctttcgagccttgcgccgcatttgaagatc
tatgctgcggaaccagagcaggcggacgacgcctataggagcttcaaggccggccatatc
atcgcggacgacgctccaaatacggtcgccgacggccttaaggtccctctcaaagacctg
acctggcacttcgtccgaaacttcgtcaccgacattcagaccgcttcggagcaggagatc
gtcgatgccatgaaggtcatctggaagcgcctgaagatcgtcatggaaccttcgagtgcc
gtaccgctggcgacaatcctgaagaaccgggaagtttttgccggaaaacgcgtcggcgtg
attgtcactggcggcaatgtcgacctcgacaagctgccttggaactga

KEGG   Aminobacter sp. MSH1: CO731_03324Help
Entry
CO731_03324       CDS       T05420                                 

Gene name
sdaB
Definition
(GenBank) L-serine dehydratase 2
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00260  Glycine, serine and threonine metabolism
amih00270  Cysteine and methionine metabolism
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01130  Biosynthesis of antibiotics
amih01200  Carbon metabolism
amih01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CO731_03324 (sdaB)
   00270 Cysteine and methionine metabolism
    CO731_03324 (sdaB)
Enzymes [BR:amih01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     CO731_03324 (sdaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SDH_alpha SDH_beta MmgE_PrpD
Motif
Other DBs
NCBI-ProteinID: AWC23851
UniProt: A0A2S0XLE7
Position
3355429..3356832
Genome map
AA seq 467 aa AA seqDB search
MFLSVFDLFKIGIGPSSSHTMGPMTAAARFLDEILSGDWPRPAGAKVDRVGASLHGSLAY
TGVGHGTDRAVMLGLFGLTPVTVDPDQTDAIVEQITGDKRVSPPGHPSYRFDPAVDLVLD
KKTPLLGHANGMAFYAYDGGDRLLLKRIYYSIGGGFVVSEEELQRMKAKTAAPAAGKRVP
YPFANAVDMLAMASRSGLSIAEMKRANEETHMARADLDAGLDAVWDAMSRCIDRGLSQDG
IMPGGLKVRRRARQLHEKLQEQWSQNRPNPLLANDWLSIYAMAVNEENAAGGRVVTAPTN
GAAGTLPAVLRYWLHFHVEADKDSIRDFLLTAAAVGGIIKTNASISGAEVGCQGEVGSAS
AMAAAGLCAVMGGTPEQVENAAEIALEHHLGMTCDPVGGLVQVPCIERNALGAVKAVTAA
SLAIKGDGKHFVPLDAAIETMRQTGMDMSEKYKETSLGGLAVNVVEC
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctttcggtattcgacctgttcaagatcggcattggtccgtcgagttcgcacacg
atggggccaatgacggccgccgcgcgcttcctcgatgagatattgagcggcgactggccg
cgcccggcaggcgccaaggttgaccgcgtcggtgctagcctgcatggctcgctggcctat
accggcgtcggccatggcaccgaccgcgccgtcatgctgggccttttcggcctgacgccc
gtcacggtggatcccgatcagaccgacgccatcgtcgagcagatcactggcgacaagcgg
gtctcgccgcccggacatccgtcctatcgcttcgatccggccgttgacctcgtgctcgac
aagaagacgccgctgctcggccatgccaacggaatggccttctatgcctatgatggcggc
gaccggctgctgctcaagcgcatctactactcgatcggcggcggcttcgtcgtctccgag
gaagaactgcagcgcatgaaggccaagaccgcggctcccgctgcgggcaagcgcgtgcct
tatccatttgccaatgccgtcgacatgctggccatggcgtcgcgcagcgggctttccatc
gccgagatgaagcgggccaacgaagagacccatatggcgcgcgccgacctcgacgccggc
ctggatgcggtctgggacgcgatgagccgctgcatcgaccggggtctgtcgcaggacggc
atcatgcccggcgggctgaaagtccgccgccgcgcccgccagctgcacgagaagctgcag
gagcagtggagccagaaccggcccaacccgctgctcgccaacgactggctgtcgatctac
gccatggcggtcaacgaggagaacgccgccggtggccgcgtcgtcacggcgccgaccaat
ggcgccgcaggtacgctgcctgccgtgctgcgctactggctgcatttccatgtcgaggcc
gacaaggacagcatccgcgacttcctgctgaccgctgccgcggtcggcggcatcatcaag
accaatgcttcgatctccggcgccgaagtcggctgccagggcgaggtgggctcggcttcg
gcgatggccgcggcaggtctgtgcgccgtcatgggcggaacgccggagcaggtcgaaaac
gcggccgagatcgcgctcgagcaccatctcggcatgacctgcgaccccgtcggcggcctc
gtccaggtgccgtgcatcgagcgcaacgcgcttggcgcggtcaaggcggtcacggcagcg
tcgctcgctatcaagggcgacggcaagcacttcgtgcctctggatgccgccatcgagacg
atgcgccagaccggcatggacatgagcgagaagtacaaggaaaccagcctcggcggtctc
gcagtcaacgtcgtcgagtgctga

KEGG   Aminobacter sp. MSH1: CO731_03811Help
Entry
CO731_03811       CDS       T05420                                 

Gene name
ilvA
Definition
(GenBank) L-threonine dehydratase biosynthetic IlvA
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00260  Glycine, serine and threonine metabolism
amih00290  Valine, leucine and isoleucine biosynthesis
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01130  Biosynthesis of antibiotics
amih01200  Carbon metabolism
amih01230  Biosynthesis of amino acids
Module
amih_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CO731_03811 (ilvA)
   00290 Valine, leucine and isoleucine biosynthesis
    CO731_03811 (ilvA)
Enzymes [BR:amih01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     CO731_03811 (ilvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_dehydrat_C
Motif
Other DBs
NCBI-ProteinID: AWC24327
UniProt: A0A2S0XMT9
Position
complement(3855835..3857091)
Genome map
AA seq 418 aa AA seqDB search
MTSFAERVSLAAEGVRQLFPETPLQENDYLSRKTGARVLLKREDLTPVRSYKIRGAFNFF
RKALAAGNQAELFVCASAGNHAQGFAFVCRHFGKKGVVFMPVTTPQQKIDKTKLFGGEFV
EIRLVGDFFDECYRAAIEFAEGSGGHMVPPFDHRDIIEGQATVALEIAAQMPGGKLPDIV
LLPVGGGGLSAGVTRYFAETGSTPRFVFCEPAGAPSLRDSLATGKRVKLAKVDNFVDGAA
VAEIGREPLRLLKEFPADAVKLVPENRLCATMIEMLNVEGVVLEPAGALAIDVLKDFSKK
ELKGKTVVAVVSGGNFDFERLPDVKERALRFEGLKKYFIIRFPQRPGALRDFLEIMGPED
DITRFEYLKKSARNFGSVLIGIETKDRRNFDLLRARFDVEGVQYQDITDNETLGGFII
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaccagttttgccgaaagggtttcgctggcggcggagggggtgaggcagctcttccca
gaaacaccgctgcaggagaacgactatctctcgcgcaagactggcgcgcgcgtgctgctc
aagcgcgaagacctgacgccggttcggtcctacaagatacgcggcgcgttcaacttcttc
cgcaaggcgcttgccgccggcaaccaggccgagctgttcgtctgcgcctcggctggcaat
cacgcccagggttttgccttcgtctgccggcatttcggcaagaagggcgtggtcttcatg
ccggtgacgacgccgcagcagaagatcgacaagaccaagctgttcggcggcgaattcgtc
gagatcaggctggtcggcgacttcttcgacgagtgctaccgcgccgccatcgaattcgcc
gagggctcgggcggccacatggtgccgcccttcgaccacagggacatcatcgagggccag
gcaacggtggcactcgagatcgccgcccagatgccgggcggcaagcttcccgacatcgtg
ctgctgccggtcggcggcggcggattgtcggccggcgtgacacgctattttgccgagacg
ggcagcacaccgcgcttcgtcttctgcgaaccggccggagcaccgagcctgcgcgacagc
ttggccaccggcaagcgcgtgaagctcgccaaggtcgacaatttcgtcgatggcgcagcc
gtagcagagatcggccgcgagccgctgcgcctgctcaaggagtttccggccgatgcggtc
aagctcgtgccggaaaaccggctctgcgccacgatgatcgagatgctgaatgtcgagggc
gtggttctggagccggcgggtgccctggcgatcgatgtgctcaaggatttttcgaagaag
gaactaaagggcaagaccgtggtggcggtggtgtcgggtggcaatttcgacttcgagcgc
ctgcccgacgtcaaggagcgcgctttgcgcttcgaggggctgaagaaatacttcatcatc
cgcttcccccagcgccccggcgccctgcgcgactttctcgagatcatgggtcccgaggac
gacatcacccgcttcgagtatctcaagaagtcggcgcgcaatttcggctcggtgctgatc
ggcatcgagaccaaggaccggcgcaatttcgacctgcttcgcgcgcgcttcgacgtcgag
ggcgtgcagtaccaggacatcaccgacaacgagacgctcggcggcttcatcatatga

KEGG   Aminobacter sp. MSH1: CO731_04444Help
Entry
CO731_04444       CDS       T05420                                 

Gene name
tdcB
Definition
(GenBank) L-threonine dehydratase catabolic TdcB
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00260  Glycine, serine and threonine metabolism
amih00290  Valine, leucine and isoleucine biosynthesis
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01130  Biosynthesis of antibiotics
amih01200  Carbon metabolism
amih01230  Biosynthesis of amino acids
Module
amih_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CO731_04444 (tdcB)
   00290 Valine, leucine and isoleucine biosynthesis
    CO731_04444 (tdcB)
Enzymes [BR:amih01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     CO731_04444 (tdcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AWC24952
UniProt: A0A2S0XPG2
Position
4517242..4518240
Genome map
AA seq 332 aa AA seqDB search
MTTTVPTLDRLRQAYAETSRATQLTPLLESAALARQTGAARVFVKAESLQWAGSFKARGA
YWRLKQLTADEARRGVVAYSSGNFAQGLAAAGQALGIPVTIVMPIDVPAAKREATKGYGA
RVVLTDHGDRAREEVAAAKAREISDTEGLALLHPFDDPEIVAGQAGAGLEALDQLAAKRV
AADIVLCPVGGGGLIGGVSLAFHYLSPSTQVFAVEPEGFNGMGSSLAHGAIETMPLGPKS
ICDGLMARKPGEAPYAAVTTTNVRGLTVEDAAIRSAMKVAFERLKLVLEPSGASSLAALL
GGKVDVAGKTVLVVATGGNVSLADFMVHVNNA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaacagtccccaccctggacaggctccgccaggcctatgccgaaacatcgcgt
gcgacgcagctgacgcccctgctcgaatccgctgcgctggcccgccagaccggcgcggcg
cgcgtcttcgtcaaggcggagtcgctgcaatgggcaggctcgttcaaggcgcgcggcgcc
tactggcggctcaagcagctcacagctgacgaggcgcggcgcggcgtggttgcctattcg
tccggcaacttcgcccagggccttgccgccgccggccaggcgctcggcattcccgtcacc
atcgtcatgccgatcgatgtgcctgcagccaagcgcgaggcgaccaagggttacggcgcc
cgcgtggtgctgaccgaccatggcgaccgcgcccgcgaagaagtcgccgccgccaaggcg
cgcgaaatctcggacaccgagggcctcgccttgctccatcccttcgacgaccccgaaatc
gtcgccggccaggccggtgccgggctcgaagcgctcgaccaactggcggcgaaacgtgtt
gcggccgacatcgtgctctgcccggtcggcggcggtggactcattggcggcgtctcgctc
gccttccactacctgtcgccatcaacacaggtgttcgcggtggaaccggaaggcttcaac
ggtatgggctcgtcgctcgcccatggcgcgatcgaaaccatgccgctgggtccgaaatcg
atctgcgacggcctgatggcacgcaagccgggcgaagcaccttatgccgcggtcacgacg
accaatgtgcgcggactgactgtcgaggacgcagccatccgcagtgcgatgaaggtagcg
ttcgagcgcctgaagctcgtgctcgagccctcgggcgcctcgtcgctggcggcacttctg
ggaggaaaggtcgacgtagccggcaagaccgtgctcgtcgtcgcaaccggcggcaacgtc
tcgctcgccgatttcatggttcatgtgaacaatgcttga

DBGET integrated database retrieval system