KEGG   Aminobacter sp. MSH1: CO731_00756Help
Entry
CO731_00756       CDS       T05420                                 

Definition
(GenBank) Soluble hydrogenase 42 kDa subunit
  KO
K00830  alanine-glyoxylate transaminase / serine-glyoxylate transaminase / serine-pyruvate transaminase [EC:2.6.1.44 2.6.1.45 2.6.1.51]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00250  Alanine, aspartate and glutamate metabolism
amih00260  Glycine, serine and threonine metabolism
amih00630  Glyoxylate and dicarboxylate metabolism
amih00680  Methane metabolism
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01120  Microbial metabolism in diverse environments
amih01130  Biosynthesis of antibiotics
amih01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CO731_00756
  09102 Energy metabolism
   00680 Methane metabolism
    CO731_00756
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CO731_00756
   00260 Glycine, serine and threonine metabolism
    CO731_00756
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:amih01007]
    CO731_00756
Enzymes [BR:amih01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.44  alanine---glyoxylate transaminase
     CO731_00756
    2.6.1.45  serine---glyoxylate transaminase
     CO731_00756
    2.6.1.51  serine---pyruvate transaminase
     CO731_00756
Amino acid related enzymes [BR:amih01007]
 Aminotransferase (transaminase)
  Class V
   CO731_00756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AWC21307
UniProt: A0A2S0XE29
Position
complement(787001..788191)
Genome map
AA seq 396 aa AA seqDB search
MSSQNPIFIPGPTNIPEVLRKAVDMPTIDHRSPLFGRILHPALDGVKKVLKATQAQIFAF
PSTGTGGWETAISNTLSAGDKVLATRNGMFSHRWIDMCQRHGLDVSVVTQSWGEGIPADL
IEEILTADKGRQIKAVLATHNETATGVRSDIAAIRRALDAAGHPALLLVDGVSSIGCMDF
RMDEWRVDIAVTGSQKGFMLPPGLAIVACSPRALASAETATLHRTFFDLRDMAKGYANNG
YPYTPPVGLLNGLKLSTEMLLEEGVENVFARHHRIASGIRAAVAAWGLRLCAVRPELYSD
TVSAIRVPDGFDANKIVSHAQNAYGVAFGTGLGDVAGKVFRIGHLGSLTDVMALSGIATA
EMVMVDLCLPIALGSGVAAAQQYYRQSIDSQKQKAA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccagaatccgattttcattcccggtccgacaaacattcctgaggtcctgcgc
aaggccgtggacatgcccaccatcgatcaccgcagcccgctattcggcaggatcttgcac
cctgccctcgatggcgtgaaaaaagtcctcaaggccacgcaggctcagatttttgcattc
ccctcgacgggaaccggcggttgggaaactgccatttcgaacacgctgtcagccggagac
aaggttctcgctactcgcaatggcatgtttagccatcgttggatcgacatgtgtcagcgt
cacggccttgacgtgtcagtcgttacgcagagctggggcgaaggcatcccagctgacctg
attgaggagatattgaccgccgacaaaggccgccagatcaaggcggtactggccacccat
aacgagacggccactggcgtgcgctctgatattgccgccatccgtcgggctcttgatgcg
gccggccacccagcgctgctccttgttgacggtgtcagctcgatcggctgcatggacttc
cgtatggacgaatggcgcgtggacatcgccgttaccggtagccagaaggggttcatgctg
ccgcccggactggccattgtcgcttgctctccaagagcactcgcatcggccgaaaccgca
accttgcaccggacgttctttgacctgcgcgacatggccaagggttatgcaaacaacggc
tatccatacacgccgccggttgggctcttgaacggtctgaagctctcgaccgagatgctg
ttggaagaaggtgtcgaaaacgtctttgcccgccatcaccgtatcgcgagcggcataagg
gctgctgtggccgcgtggggactgcgcctatgtgctgttcgcccggagctctattccgac
actgtgagcgcgatccgcgtcccagacggcttcgatgccaacaagatcgtgtcgcacgct
cagaacgcatacggcgtagccttcgggaccggacttggagacgtcgctgggaaggtcttc
cgcattggccatctcggcagcctcacagatgtaatggccctttctggtatcgccactgcc
gaaatggtcatggttgatctctgtcttcccatcgcgctcggctcgggcgtagccgcagca
cagcagtattatcgccaaagtatcgattcgcaaaagcaaaaggccgcgtga

DBGET integrated database retrieval system