KEGG   Aminobacter sp. MSH1: CO731_00769Help
Entry
CO731_00769       CDS       T05420                                 

Gene name
aroA
Definition
(GenBank) 3-phosphoshikimate 1-carboxyvinyltransferase
  KO
K00800  3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01130  Biosynthesis of antibiotics
amih01230  Biosynthesis of amino acids
Module
amih_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CO731_00769 (aroA)
Enzymes [BR:amih01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.19  3-phosphoshikimate 1-carboxyvinyltransferase
     CO731_00769 (aroA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase CHB_HEX_C
Motif
Other DBs
NCBI-ProteinID: AWC21319
UniProt: A0A2S0XE61
Position
802366..803718
Genome map
AA seq 450 aa AA seqDB search
MSHQAVPQPAVARKSKSLSGTARIPGDKSISHRSFMFGGLASGETRITGLLEGEDVMRTG
DAMKAMGAHIDRRGAEWIITGTGNGALLQAEAPLDFGNAGTGSRLTMGLVGTYDMETTFI
GDASLSGRPMGRVLDPLRQMGVQVIDAAPGDRMPLTLRGPRQAAPITYRVPMASAQVKSA
VLLAALNTPGITTVIEPVMTRDHTEKMLKGFGANIEVETDEQGVRHIFIEGQGKLIGQVI
AVPGDPSSAGFPLVAALIVPGSDITIENVLMNPTRTGLITTLIEMGGKIDILNPRNAGGE
DVADLRVRGSELKGVKVPAERAPSMIDEYPVLAVAACFAEGETLMQGLEELRVKESDRLA
AVARGLEANGADCTEGETTLSVRGVPGGKGLGGGTVKTHLDHRIAMSFLVMGLASEKPVT
VDDQAMIATSFPEFMGLMADLGAEIDQTAA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcatcaagctgtgccacagccggccgtcgcccggaagtcaaaatcgctgtctgga
accgcccgcatcccgggcgacaagtcgatttcgcaccgctccttcatgttcggcggcctc
gcatcgggcgaaacccgcatcaccggcctgctcgagggcgaagacgtgatgcgcaccggc
gacgccatgaaggcgatgggcgcgcatatcgacaggcgcggcgcggaatggatcatcacc
ggtaccggcaacggtgccctgctgcaggccgaagcgccgctcgatttcggcaacgccggc
accggctcgcgcctgaccatgggcctggtcggaacctatgacatggaaaccaccttcatc
ggcgacgcctcgctgtcgggcaggccgatgggccgcgtgctcgatccgctgcgccagatg
ggcgtgcaggtcatcgacgccgcgcccggcgaccgcatgccgctgacgctgcgcggcccg
cgccaggccgcccccatcacctaccgcgtgccaatggcctcggcgcaggtgaagtcggcg
gtgctgctcgccgccctcaacacgccgggaatcaccaccgtcatcgagccggtgatgacc
cgcgaccacaccgaaaagatgctgaagggcttcggcgccaacatcgaggtcgagaccgac
gagcagggcgtgcgccacatcttcatcgaaggccagggcaagttgatcggccaggtcatc
gccgtgccgggcgatccgtcctcggccggcttcccgctggtcgcagcactgatcgtgcca
ggctccgacatcaccatcgaaaacgtgctgatgaacccgacgcgtaccggcctgatcacc
acgctgatcgaaatgggcggcaagatcgacatcctcaacccgcgcaatgccggcggcgag
gatgtggccgacctgcgcgtgcgcggctccgaactcaagggcgtcaaggtcccggccgag
cgggcgccgtcgatgatcgacgaatatccggtgctggcggtcgcggcctgctttgccgag
ggcgaaaccctgatgcagggcctggaagaactccgcgtcaaggaatccgacaggctggcc
gccgttgcccgcggcctcgaagccaatggcgccgactgcaccgaaggcgagaccacgctt
tccgtccgtggcgttcccggcggcaagggtctcggcggcggcacggtcaagacccatctc
gaccaccgcatcgccatgagcttcctggtcatgggccttgcttccgaaaagcccgtcacc
gtcgacgaccaggcgatgatcgcgaccagcttcccggaattcatgggactgatggcagat
ctgggagccgagatcgaccagaccgccgcttga

DBGET integrated database retrieval system